Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-15 (IL15)

Product Specifications

Product Name Alternative

/

Abbreviation

Recombinant Human IL15 protein

Gene Name

IL15

UniProt

P40933

Expression Region

49-162aa

Organism

Homo sapiens (Human)

Target Sequence

NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

Tag

C-terminal hFc1-Myc-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Cytokine that stimulates the proliferation of T-lymphocytes (PubMed:8178155) . Stimulation by IL15 requires interaction of IL15 with components of the IL2 receptor, including IL2RB and probably IL2RG but not IL2RA (PubMed:8178155) . In neutrophils, stimulates phagocytosis probably by signaling through the IL15 receptor, composed of the subunits IL15RA, IL2RB and IL2RG, which results in kinase SYK activation (PubMed:15123770) .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

41.7 kDa

References & Citations

"Genomic sequence and chromosomal location of the human interleukin-15 gene (IL15) ." Krause H., Jandrig B., Wernicke C., Bulfone-Paus S., Pohl T., Diamantstein T. Cytokine 8:667-674 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Lung: right lower lobe
CR561134 5 µg

Tissue Total RNA, Lung: right lower lobe

Sign In for Pricing
View Details
PDILT (NM_174924) Human Recombinant Protein
TP720435 10 µg

PDILT (NM_174924) Human Recombinant Protein

Sign In for Pricing
View Details
Buccutite™ Rapid PE-Texas Red Tandem Antibody Labeling Kit *Production Scale Optimized for Labeling 1 mg Antibody Per Reaction*
5412-AAT 2 Labelings

Buccutite™ Rapid PE-Texas Red Tandem Antibody Labeling Kit *Production Scale Optimized for Labeling 1 mg Antibody Per Reaction*

Sign In for Pricing
View Details
Argonaute 2 (AGO2) Human Gene Knockout Kit (CRISPR)
KN418078 1 Kit

Argonaute 2 (AGO2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human FAM123C (AMER3) activation kit by CRISPRa
GA116460 1 Kit

Human FAM123C (AMER3) activation kit by CRISPRa

Sign In for Pricing
View Details
Alpha-Pinene Oxide
TRC-P466620-250MG 250 mg

Alpha-Pinene Oxide

Sign In for Pricing
View Details