Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aeromonas sobria Aerolysin (asa1)

Product Specifications

Product Name Alternative

(Hemolysin)

Abbreviation

Recombinant Aeromonas sobria asa1 protein

Gene Name

Asa1

UniProt

Q06304

Expression Region

25-443aa

Organism

Aeromonas sobria

Target Sequence

AEPVYPDQVKWAGLGTGVCASGYRPLTRDEAMSIKGNLVSRMGQWQITGLADRWVIMGPGYNGEIKQGTAGETWCYPNSPVSGEIPTLSDWNIPAGDEVDVQWRLVHDNDYFIKPVSYLAHYLGYAWVGGNHSPYVGEDMDVTRVGDGWLIKGNNDGGCSGYRCGEKSSIKVSNFSYTLEPDSFSHGQVTESGKQLVKTITANATNYTDLPQQVVVTLKYDKATNWSKTDTYSLSEKVTTKNKFQWPLVGETELAIEIAASQSWASQKGGSTTETVSVEARPTVPPHSSLPVRVALYKSNISYPYEFKAEVNYDLTMKGFLRWGGNAWYTHPDNRPTWEHTLLLGPFRGQGEQHPLPVDKRYIPGEVKWWDWNWTISEYGLSTMQNNLGRVLRPIRSAVTGDFYAESQFAGDIEIGQPQ

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Secreted, cytolytic toxin that forms pores in host membranes after proteolytic removal of a C-terminal propeptide, leading to destruction of the membrane permeability barrier and cell death. The pores are formed by transmembrane beta-strands and are approximately 3 nm in diameter.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

54.2 kDa

References & Citations

"Nucleotide sequences and characterization of haemolysin genes from Aeromonas hydrophila and Aeromonas sobria." Hirono I., Aoki T., Asao T., Kozaki S. Microb. Pathog. 13:433-446 (1992)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP60 (LK1), CF640R conjugate, 0.1mg/mL
BNC400851-500 1x 500 µL

HSP60 (LK1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF594 conjugate, 0.1mg/mL
BNC940676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (rVEGI/1283), CF488A conjugate, 0.1mg/mL
BNC882059-500 1x 500 µL

TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (rVEGI/1283), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10/13 (DE-K13), CF647 conjugate, 0.1mg/mL
BNC470696-500 1x 500 µL

Cytokeratin 10/13 (DE-K13), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD66 (CEA) (CEA31), CF740 conjugate, 0.1mg/mL
BNC740670-100 1x 100 µL

CD66 (CEA) (CEA31), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Retinol Binding Protein-1 (RBP/872), CF568 conjugate, 0.1mg/mL
BNC680872-500 1x 500 µL

Retinol Binding Protein-1 (RBP/872), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details