Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-13 (IL13)

Product Specifications

Product Name Alternative

(IL-13)

Abbreviation

Recombinant Human IL13 protein

Gene Name

IL13

UniProt

P35225

Expression Region

25-146aa

Organism

Homo sapiens (Human)

Target Sequence

LTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cytokine

Relevance

Cytokine . Inhibits inflammatory cytokine production . Synergizes with IL2 in regulating interferon-gamma synthesis . May be critical in regulating inflammatory and immune responses . Positively regulates IL31RA expression in macrophages.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.3 kDa

References & Citations

"Interleukin-13 is a new human lymphokine regulating inflammatory and immune responses." Minty A.J., Chalon P., Derocq J.-M., Dumont X., Guillemot J.-C., Kaghad M., Labit C., Leplatois P., Liauzun P., Miloux B., Minty C., Casellas P., Loison G., Lupker J., Shire D., Ferrara P., Caput D. Nature 362:248-250 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cmah activation kit by CRISPRa
GA200765 1 Kit

Mouse Cmah activation kit by CRISPRa

Sign In for Pricing
View Details
SEC14 like protein 2 (SEC14L2) Rabbit Polyclonal Antibody
TA381323 100 µL

SEC14 like protein 2 (SEC14L2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GLEPP1 (PTPRO) (NM_030671) Human Recombinant Protein
TP320785 20 µg

GLEPP1 (PTPRO) (NM_030671) Human Recombinant Protein

Sign In for Pricing
View Details
MAPKAP Kinase 2 (MAPKAPK2) Rabbit Polyclonal Antibody
AP02791PU-N 100 µL

MAPKAP Kinase 2 (MAPKAPK2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TGFalpha (P/T1), CF568 conjugate, 0.1mg/mL
BNC680787-100 1x 100 µL

TGFalpha (P/T1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Lox Mouse Gene Knockout Kit (CRISPR)
KN309375 1 Kit

Lox Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details