Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-13 (IL13)

Product Specifications

Product Name Alternative

(IL-13)

Abbreviation

Recombinant Human IL13 protein

Gene Name

IL13

UniProt

P35225

Expression Region

25-146aa

Organism

Homo sapiens (Human)

Target Sequence

LTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cytokine

Relevance

Cytokine . Inhibits inflammatory cytokine production . Synergizes with IL2 in regulating interferon-gamma synthesis . May be critical in regulating inflammatory and immune responses . Positively regulates IL31RA expression in macrophages.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.3 kDa

References & Citations

"Interleukin-13 is a new human lymphokine regulating inflammatory and immune responses." Minty A.J., Chalon P., Derocq J.-M., Dumont X., Guillemot J.-C., Kaghad M., Labit C., Leplatois P., Liauzun P., Miloux B., Minty C., Casellas P., Loison G., Lupker J., Shire D., Ferrara P., Caput D. Nature 362:248-250 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TOM1L2 activation kit by CRISPRa
GA115570 1 Kit

Human TOM1L2 activation kit by CRISPRa

Sign In for Pricing
View Details
Human IL-17A (Interleukin 17A) solid ELISPOT Kit
ESP-H0004S-01 96 Tests

Human IL-17A (Interleukin 17A) solid ELISPOT Kit

Sign In for Pricing
View Details
Human IL-17A (Interleukin 17A) solid ELISPOT Kit
ESP-H0004S-02 5x 96 Tests

Human IL-17A (Interleukin 17A) solid ELISPOT Kit

Sign In for Pricing
View Details
HIS Lite™ Cy3 Tris NTA-Ni Complex
12620-AAT 100 µg

HIS Lite™ Cy3 Tris NTA-Ni Complex

Sign In for Pricing
View Details
Hexokinase 1 Recombinant Rabbit Monoclonal Antibody [ST47-05]
ET1609-28 100 µL

Hexokinase 1 Recombinant Rabbit Monoclonal Antibody [ST47-05]

Sign In for Pricing
View Details
FFAR2 Antibody
8G249-AAT 50 µg

FFAR2 Antibody

Sign In for Pricing
View Details