Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-13 (IL13)

Product Specifications

Product Name Alternative

(IL-13)

Abbreviation

Recombinant Human IL13 protein

Gene Name

IL13

UniProt

P35225

Expression Region

25-146aa

Organism

Homo sapiens (Human)

Target Sequence

LTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cytokine

Relevance

Cytokine . Inhibits inflammatory cytokine production . Synergizes with IL2 in regulating interferon-gamma synthesis . May be critical in regulating inflammatory and immune responses . Positively regulates IL31RA expression in macrophages.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.3 kDa

References & Citations

"Interleukin-13 is a new human lymphokine regulating inflammatory and immune responses." Minty A.J., Chalon P., Derocq J.-M., Dumont X., Guillemot J.-C., Kaghad M., Labit C., Leplatois P., Liauzun P., Miloux B., Minty C., Casellas P., Loison G., Lupker J., Shire D., Ferrara P., Caput D. Nature 362:248-250 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB34 (NM_001142625) Human Over-expression Lysate
LC428219 20 µg

RAB34 (NM_001142625) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Actg1 activation kit by CRISPRa
GA200045 1 Kit

Mouse Actg1 activation kit by CRISPRa

Sign In for Pricing
View Details
FOXO1 Rabbit Monoclonal Antibody [Clone ID: R07-7C4]
TA384252 100 µL

FOXO1 Rabbit Monoclonal Antibody [Clone ID: R07-7C4]

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS508204 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
MAFK Mouse Monoclonal Antibody [Clone ID: AT2F7]
AM50032PU-N 100 µL

MAFK Mouse Monoclonal Antibody [Clone ID: AT2F7]

Sign In for Pricing
View Details
FITC Anti-Human CD61 Antibody[VI-PL2]
E-AB-F1166C-01 20 Tests

FITC Anti-Human CD61 Antibody[VI-PL2]

Sign In for Pricing
View Details