Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCblR/CD320, Human (HEK293, His)

TCblR/CD320 is the receptor for cobalamin (TCbl) and is critical for cellular cobalamin homeostasis and B cell responses. It is expressed on follicular dendritic cells, interacts with germinal center B cells, and coordinates immune responses. TCblR/CD320 Protein, Human (HEK293, His) is the recombinant human-derived TCblR/CD320 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TCblR/CD320 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tcblr-cd320-protein-human-hek-293-his.html

Purity

98.0

Smiles

SPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGV

Molecular Formula

51293 (Gene_ID) Q9NPF0-1 (S36-V231) (Accession)

Molecular Weight

37-57 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC18 / Mucin 18 / CD146 (OJ79c), CF594 conjugate, 0.1mg/mL
BNC940676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF640R conjugate, 0.1mg/mL
BNC400978-100 1x 100 µL

CD7 (T3-3A1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF647 conjugate, 0.1mg/mL
BNC470012-500 1x 500 µL

Tyrosinase (T311), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TTF-1 / NKX2.1 (8G7G3/1), CF647 conjugate, 0.1mg/mL
BNC470448-500 1x 500 µL

TTF-1 / NKX2.1 (8G7G3/1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGFalpha (MF9), CF405S conjugate, 0.1mg/mL
BNC040644-100 1x 100 µL

TGFalpha (MF9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1373), CF568 conjugate, 0.1mg/mL
BNC681373-100 1x 100 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1373), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details