Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCblR/CD320, Human (HEK293, His)

TCblR/CD320 is the receptor for cobalamin (TCbl) and is critical for cellular cobalamin homeostasis and B cell responses. It is expressed on follicular dendritic cells, interacts with germinal center B cells, and coordinates immune responses. TCblR/CD320 Protein, Human (HEK293, His) is the recombinant human-derived TCblR/CD320 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TCblR/CD320 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tcblr-cd320-protein-human-hek-293-his.html

Purity

98.0

Smiles

SPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGV

Molecular Formula

51293 (Gene_ID) Q9NPF0-1 (S36-V231) (Accession)

Molecular Weight

37-57 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITIH4 Protein, Human, Recombinant (His & SUMO)
TMPH-01542-01 5 µg

ITIH4 Protein, Human, Recombinant (His & SUMO)

Sign In for Pricing
View Details
ITIH4 Protein, Human, Recombinant (His & SUMO)
TMPH-01542-02 10 µg

ITIH4 Protein, Human, Recombinant (His & SUMO)

Sign In for Pricing
View Details
ITIH4 Protein, Human, Recombinant (His & SUMO)
TMPH-01542-03 20 µg

ITIH4 Protein, Human, Recombinant (His & SUMO)

Sign In for Pricing
View Details
ITIH4 Protein, Human, Recombinant (His & SUMO)
TMPH-01542-04 50 µg

ITIH4 Protein, Human, Recombinant (His & SUMO)

Sign In for Pricing
View Details
ITIH4 Protein, Human, Recombinant (His & SUMO)
TMPH-01542-05 100 µg

ITIH4 Protein, Human, Recombinant (His & SUMO)

Sign In for Pricing
View Details
ITIH4 Protein, Human, Recombinant (His & SUMO)
TMPH-01542-06 200 µg

ITIH4 Protein, Human, Recombinant (His & SUMO)

Sign In for Pricing
View Details