Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-15R alpha, Mouse (HEK293, hFc)

IL-15R alpha is a high affinity receptor for IL-15 (Kd: 100 pM) [1]. IL-15R alpha binds IL-15 and thereby activating the antitumor functions of NK cells and CD8+ T cells[2]. IL-15R alpha plays an important role in memory CD8+ T cell homeostasis and lymphocyte development[3]. IL-15R alpha Protein, Mouse (HEK293, hFc) is a recombinant mouse extracellular region of IL-15R alpha (G33-K205) with a C-Terminal hFc tag, which is produced in HEK293 cells.

Product Specifications

Product Name Alternative

IL-15R alpha Protein, Mouse (HEK293, hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-15r-alpha-protein-mouse-hek293-hfc.html

Purity

97.90

Smiles

GTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHYSPVPTVVTPKVTSQPESPSPSAKEPEAFSPKSDTAMTTETAIMPGSRLTPSQTTSAGTTGTGSHKSSRAPSLAATMTLEPTASTSLRITEISPHSSKMTK

Molecular Formula

16169 (Gene_ID) Q60819-1 (G33-K205) (Accession)

Molecular Weight

46-90 kDa.

References & Citations

[1]Yin Guo, et al. Immunobiology of the IL-15/IL-15Rα complex as an antitumor and antiviral agent. Cytokine Growth Factor Rev. 2017 Dec;38:10-21.|[2]Johan Mj Van den Bergh, et al. IL-15 receptor alpha as the magic wand to boost the success of IL-15 antitumor therapies: The upswing of IL-15 transpresentation. Pharmacol Ther. 2017 Feb;170:73-79.|[3]Spencer W Stonier, et al. Trans-presentation: a novel mechanism regulating IL-15 delivery and responses. Immunol Lett. 2010 Jan 4;127 (2) :85-92.|[4]Patrick R Burkett, et al. IL-15R alpha expression on CD8+ T cells is dispensable for T cell memory. Proc Natl Acad Sci U S A. 2003 Apr 15;100 (8) :4724-9.|[5]Jing Wei, et al. Tumor cell-expressed IL-15Rα drives antagonistic effects on the progression and immune control of gastric cancer and is epigenetically regulated in EBV-positive gastric cancer. Cell Oncol (Dordr) . 2020 Dec;43 (6) :1085-1097.|[6]Emanuela Romano, et al. Human Langerhans cells use an IL-15R-α/IL-15/pSTAT5-dependent mechanism to break T-cell tolerance against the self-differentiation tumor antigen WT1. Blood. 2012 May 31;119 (22) :5182-90.|[7]J P Lodolce, et al. IL-15 receptor maintains lymphoid homeostasis by supporting lymphocyte homing and proliferation. Immunity. 1998 Nov;9 (5) :669-76.|[8]J G Giri, et al. Identification and cloning of a novel IL-15 binding protein that is structurally related to the alpha chain of the IL-2 receptor.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Chuk Pre-designed siRNA Set A
SI102594A 1 Each

Mouse Chuk Pre-designed siRNA Set A

Sign In for Pricing
View Details
IPSU 2mg
A21276-2 2 mg

IPSU 2mg

Sign In for Pricing
View Details
C18orf55 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV810912 1.0 µg DNA

C18orf55 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
C10orf111 Antibody, HRP conjugated
A63882-50UG 50 µg

C10orf111 Antibody, HRP conjugated

Sign In for Pricing
View Details
Rabbit Anti-Human HES6 pAb
PA10249-01 50 μL

Rabbit Anti-Human HES6 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human HES6 pAb
PA10249-02 100 μL

Rabbit Anti-Human HES6 pAb

Sign In for Pricing
View Details