Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

p53 DINP1 (TP53INP1) (N-term) rabbit polyclonal antibody, Aff - Purified

Product Specifications

CAS Number

9007-83-4

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDNF Rabbit Polyclonal Antibody
TA383985 100 µL

CDNF Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MHC Class 1, HLA G (MaxLight 650)
MBS6256168-01 0.1 mL

MHC Class 1, HLA G (MaxLight 650)

Sign In for Pricing
View Details
MHC Class 1, HLA G (MaxLight 650)
MBS6256168-02 5x 0.1 mL

MHC Class 1, HLA G (MaxLight 650)

Sign In for Pricing
View Details
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
HY-P1229-01 5 mg

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Sign In for Pricing
View Details
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
HY-P1229-02 10 mg

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Sign In for Pricing
View Details
HAND2 (Heart and Neural Crest Derivatives Expressed 2, DHAND2, FLJ16260, Hed, MGC125303, MGC125304, Thing2, bHLHa26, dHand) (AP)
MBS6162979-01 0.1 mL

HAND2 (Heart and Neural Crest Derivatives Expressed 2, DHAND2, FLJ16260, Hed, MGC125303, MGC125304, Thing2, bHLHa26, dHand) (AP)

Sign In for Pricing
View Details