Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Azotobacter vinelandii Uncharacterized protein in nifU 5'region

Product Specifications

CAS Number

9000-83-3

Storage Conditions

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Short Name

[Uncharacterized protein in nifU 5'region]

Other Product Names

[iron-sulfur cluster assembly accessory protein; Uncharacterized protein in nifU 5'region; ORF6]

NCBI GI Number

502027656

NCBI Accession Number

WP_012698852.1

NCBI GB Accession Number

WP_012698852.1

Uniprot Accession Number

Q44540

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN
MBS5818107 Inquire

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN

Sign In for Pricing
View Details
Rat Nkiras1 Pre-designed siRNA Set B
SI209335B 1 Each

Rat Nkiras1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
T-Box Protein 15 (TBX15) Antibody
abx309391-01 20 µg

T-Box Protein 15 (TBX15) Antibody

Sign In for Pricing
View Details
T-Box Protein 15 (TBX15) Antibody
abx309391-02 50 µg

T-Box Protein 15 (TBX15) Antibody

Sign In for Pricing
View Details
T-Box Protein 15 (TBX15) Antibody
abx309391-03 100 µg

T-Box Protein 15 (TBX15) Antibody

Sign In for Pricing
View Details
T-Box Protein 15 (TBX15) Antibody
abx309391-04 200 µg

T-Box Protein 15 (TBX15) Antibody

Sign In for Pricing
View Details