PHS, Human (His)
PHS protein is crucial in tetrahydrobiopterin biosynthesis and has the dual function of hindering the formation of 7-pterin and promoting quinone-BH2. It also acts as a coactivator of HNF1A-dependent transcription, affecting HNF1A dimerization and enhancing its activity. PHS Protein, Human (His) is the recombinant human-derived PHS protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
PHS Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/phs-protein-human-his.html
Smiles
AGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
Molecular Formula
5092 (Gene_ID) P61457-1 (A2-T104) (Accession)
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Heavy chain cardiac Myosin Rabbit pAb, BF700 conjugated
PSD93 (DLG2) (NM_001142699) Human Over-expression Lysate