Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse IL-10

IL-10 is an anti-inflammatory cytokine and a member of the IL-10 family of cytokines, which have indispensable functions in many infectious and inflammatory diseases. Mouse IL-10 Recombinant Protein is purified interleukin-10 produced in yeast.

Product Specifications

CAS Number

9000-83-3

Source

Yeast

Sequence

SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYL GCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKA VEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS (160)

Assay Principle

The Mouse IFN gamma protein can be used in cell culture, as an IFN gamma ELISA Standard, and as a Western Blot Control.

Shipping Conditions

Dry Ice

Storage Conditions

-20°C

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp652 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4903708 1.0 µg DNA

Zfp652 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
ING1 Antibody, Biotin conjugated
CSB-PA891532LD01HU-01 50 µg

ING1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
ING1 Antibody, Biotin conjugated
CSB-PA891532LD01HU-02 100 µg

ING1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rat Suppressors Of Cytokine Signaling 2 (SOCS2) ELISA Kit
RD-SOCS2-Ra-48Tests 48 Tests

Rat Suppressors Of Cytokine Signaling 2 (SOCS2) ELISA Kit

Sign In for Pricing
View Details
CTDSPL (NM_005808) Human Untagged Clone
SC128039 10 µg

CTDSPL (NM_005808) Human Untagged Clone

Sign In for Pricing
View Details
Recombinant Human UBE2S Protein, N-His
bs-102099P-01 20 µg

Recombinant Human UBE2S Protein, N-His

Sign In for Pricing
View Details