Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse IL-6

Interleukin-6 (IL-6) is an interleukin that acts as both a pro-inflammatory and anti-inflammatory cytokine. Mouse IL-6 Recombinant Protein is purified interleukin-6 produced in yeast.

Product Specifications

CAS Number

9000-83-3

Source

Yeast

Sequence

FPTSQVRRGDFTEDTTPNRPVYTTSQVGGLITHVLWEIVEMRKELCNGNSDCMNNDDALA ENNLKLPEIQRNDGCYQTGYNQEICLLKISSGLLEYHSYLEYMKNNLKDNKKDKARVLQR DTETLIHIFNQEVKDLHKIVLPTPISNALLTDKLESQKEWLRTKTIQFILKSLEEFLKVT LRSTRQT (187)

Assay Principle

The Mouse IL-10 protein can be used in cell culture, as an IL-10 ELISA Standard, and as a Western Blot Control.

Shipping Conditions

Dry Ice

Storage Conditions

-20°C

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Catenin Alpha 3 (CTNNA3) ELISA kit
GTR10420619 96 Well

Bovine Catenin Alpha 3 (CTNNA3) ELISA kit

Sign In for Pricing
View Details
Recombinant Human Lymphocyte antigen 6E
MBS9421140-01 0.02 mg

Recombinant Human Lymphocyte antigen 6E

Sign In for Pricing
View Details
Recombinant Human Lymphocyte antigen 6E
MBS9421140-02 0.1 mg

Recombinant Human Lymphocyte antigen 6E

Sign In for Pricing
View Details
Recombinant Human Lymphocyte antigen 6E
MBS9421140-03 1 mg

Recombinant Human Lymphocyte antigen 6E

Sign In for Pricing
View Details
Recombinant Human Lymphocyte antigen 6E
MBS9421140-04 5x 1 mg

Recombinant Human Lymphocyte antigen 6E

Sign In for Pricing
View Details
KIFC1 Antibody
MBS9521630-01 0.04 mL

KIFC1 Antibody

Sign In for Pricing
View Details