Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse TNF alpha

Tumor necrosis factor alpha (TNFSF2, TNF alpha) is a member of the TNF Superfamily. TNF alpha, being an endogenous pyrogen, is able to induce fever, to induce apoptotic cell death, to induce sepsis (through IL-1 & IL-6 production), to induce cachexia, induce inflammation, and to inhibit tumorigenesis and viral replication. Mouse TNF alpha Recombinant Protein is purified TNF alpha (TNFSF2) produced in yeast.

Product Specifications

CAS Number

9000-83-3

Source

Yeast

Sequence

LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYS QVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLG GVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL (156)

Assay Principle

The Mouse IL-6 protein can be used in cell culture, as an IL-6 ELISA Standard, and as a Western Blot Control.

Shipping Conditions

Dry Ice

Storage Conditions

-20°C

More Discoveries

Explore Other Products

Browse additional items from our catalog

Muc1 ELISA Kit (Mouse) (OKEH04555)
OKEH04555 96 Well

Muc1 ELISA Kit (Mouse) (OKEH04555)

Sign In for Pricing
View Details
LGALS9 Polyclonal Antibody
E-AB-19489-01 20 µL

LGALS9 Polyclonal Antibody

Sign In for Pricing
View Details
LGALS9 Polyclonal Antibody
E-AB-19489-02 60 µL

LGALS9 Polyclonal Antibody

Sign In for Pricing
View Details
LGALS9 Polyclonal Antibody
E-AB-19489-03 120 µL

LGALS9 Polyclonal Antibody

Sign In for Pricing
View Details
LGALS9 Polyclonal Antibody
E-AB-19489-04 200 µL

LGALS9 Polyclonal Antibody

Sign In for Pricing
View Details
LuAF60097
orb2814886-01 10 mg

LuAF60097

Sign In for Pricing
View Details