Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse TNF alpha

Tumor necrosis factor alpha (TNFSF2, TNF alpha) is a member of the TNF Superfamily. TNF alpha, being an endogenous pyrogen, is able to induce fever, to induce apoptotic cell death, to induce sepsis (through IL-1 & IL-6 production), to induce cachexia, induce inflammation, and to inhibit tumorigenesis and viral replication. Mouse TNF alpha Recombinant Protein is purified TNF alpha (TNFSF2) produced in yeast.

Product Specifications

CAS Number

9000-83-3

Source

Yeast

Sequence

LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYS QVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLG GVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL (156)

Assay Principle

The Mouse IL-6 protein can be used in cell culture, as an IL-6 ELISA Standard, and as a Western Blot Control.

Shipping Conditions

Dry Ice

Storage Conditions

-20°C

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rad23A shRNA (m) Lentiviral Particles
sc-61436-V 200 µL

Rad23A shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Mouse Nuclear pore complex protein Nup107, Nup107 ELISA KIT
ELI-38239m 96 Tests

Mouse Nuclear pore complex protein Nup107, Nup107 ELISA KIT

Sign In for Pricing
View Details
Tmx4 (NM_029148) Mouse Tagged ORF Clone Lentiviral Particle
MR217354L4V 200 µL

Tmx4 (NM_029148) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
DppC Antibody
orb813759 2 mg

DppC Antibody

Sign In for Pricing
View Details
Anti-SLC22A8 antibody
STJ25568 100 µl

Anti-SLC22A8 antibody

Sign In for Pricing
View Details
7-Azaspiro[4.5]decan-9-ol hydrochloride
APD14626-01 50 mg

7-Azaspiro[4.5]decan-9-ol hydrochloride

Sign In for Pricing
View Details