Recombinant Mouse APRIL
A proliferation-inducing ligand (APRIL), also known as TNFSF13, is a member of the tumor necrosis factor (TNF) ligand superfamily. APRIL/TNFSF13 has been shown to play a role in protecting cells from undergoing apoptosis and promoting B cell development. Mouse APRIL Recombinant Protein is purified APRIL (TNFSF13) produced in yeast.
Product Specifications
CAS Number
9000-83-3
Source
Yeast
Sequence
AVLTQKHKKKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYL LYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDI ITVKIPRANAKLSLSPHGTFLGFVKL (146)
Assay Principle
The Mouse VEGF-A protein can be used in cell culture, as a VEGF-A ELISA Standard, and as a Western Blot Control.
Shipping Conditions
Dry Ice
Storage Conditions
-20°C
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS542117-01 0.1 mg
Myeloperoxidase Antibody BIOTIN-Conjugated C-epitope
Sign In for Pricing
View Details 
MBS542117-02 5x 0.1 mg
Myeloperoxidase Antibody BIOTIN-Conjugated C-epitope
Sign In for Pricing
View Details E45H36132M5 20 µg
Citrate synthetase (CS) (NM_004077) Human Recombinant Protein
Sign In for Pricing
View Details ![2-Amino-1-[3,5-bis (trifluoromethyl) phenyl]ethan-1-ol](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
CJB39217-01 50 mg
2-Amino-1-[3,5-bis (trifluoromethyl) phenyl]ethan-1-ol
Sign In for Pricing
View Details