Recombinant Mouse APRIL
A proliferation-inducing ligand (APRIL), also known as TNFSF13, is a member of the tumor necrosis factor (TNF) ligand superfamily. APRIL/TNFSF13 has been shown to play a role in protecting cells from undergoing apoptosis and promoting B cell development. Mouse APRIL Recombinant Protein is purified APRIL (TNFSF13) produced in yeast.
Product Specifications
CAS Number
9000-83-3
Source
Yeast
Sequence
AVLTQKHKKKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYL LYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDI ITVKIPRANAKLSLSPHGTFLGFVKL (146)
Assay Principle
The Mouse VEGF-A protein can be used in cell culture, as a VEGF-A ELISA Standard, and as a Western Blot Control.
Shipping Conditions
Dry Ice
Storage Conditions
-20°C
More Discoveries
Explore Other Products
Browse additional items from our catalog
E45H01788-2 20 µg
RNF156 (mgRN1) (NM_001142290) Human Over-expression Lysate
Sign In for Pricing
View Details 
MBS6235566-01 0.1 mL
ST5 (Suppression of Tumorigenicity 5 Protein, DENN Domain-containing Protein 2B, HeLa Tumor Suppression 1, DENND2B, HTS1, MGC33090) (MaxLight 750)
Sign In for Pricing
View Details MBS6235566-02 5x 0.1 mL
ST5 (Suppression of Tumorigenicity 5 Protein, DENN Domain-containing Protein 2B, HeLa Tumor Suppression 1, DENND2B, HTS1, MGC33090) (MaxLight 750)
Sign In for Pricing
View Details ANT-37235-1mg 1 mg
HIV1 env/Env polyprotein, InVivo Block/Neutralizing Antibody
Sign In for Pricing
View Details