Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse IL-1 beta

IL-1 beta (IL-1β) is a member of the interleukin 1 family of cytokines. The IL-1 beta cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. Mouse IL-1 beta Recombinant Protein is purified interleukin-1 beta cytokine produced in yeast.

Product Specifications

CAS Number

9000-83-3

Source

Yeast

Sequence

VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVAL GLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNW YISTSQAEHKPVFLGNNSGQDIIDFTMESVSS (152)

Assay Principle

The Mouse APRIL protein can be used in cell culture, such as an APRIL ELISA Standard, and as a Western Blot Control.

Shipping Conditions

Dry Ice

Storage Conditions

-20°C

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(Z) -Nifuratel
RM-N131123-01 10 mg

(Z) -Nifuratel

Sign In for Pricing
View Details
(Z) -Nifuratel
RM-N131123-02 25 mg

(Z) -Nifuratel

Sign In for Pricing
View Details
(Z) -Nifuratel
RM-N131123-03 50 mg

(Z) -Nifuratel

Sign In for Pricing
View Details
(Z) -Nifuratel
RM-N131123-04 100 mg

(Z) -Nifuratel

Sign In for Pricing
View Details
KCTD20 AAV Vector (Human) (CMV)
25451101 1 µg

KCTD20 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Olr528 (NM_001000319) Rat Untagged Clone
RN211326 10 µg

Olr528 (NM_001000319) Rat Untagged Clone

Sign In for Pricing
View Details