Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse IL-1 beta

IL-1 beta (IL-1β) is a member of the interleukin 1 family of cytokines. The IL-1 beta cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. Mouse IL-1 beta Recombinant Protein is purified interleukin-1 beta cytokine produced in yeast.

Product Specifications

CAS Number

9000-83-3

Source

Yeast

Sequence

VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVAL GLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNW YISTSQAEHKPVFLGNNSGQDIIDFTMESVSS (152)

Assay Principle

The Mouse APRIL protein can be used in cell culture, such as an APRIL ELISA Standard, and as a Western Blot Control.

Shipping Conditions

Dry Ice

Storage Conditions

-20°C

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

anti-FPRL1
YF-PA11849 100 ul

anti-FPRL1

Sign In for Pricing
View Details
ZNF423 Peptide
DF15383-BP 1 mg

ZNF423 Peptide

Sign In for Pricing
View Details
Recombinant Cynomolgus monkey CD274/PD-L1/B7-H1 Protein, C-His (Active)
AWJ70102 100 μg

Recombinant Cynomolgus monkey CD274/PD-L1/B7-H1 Protein, C-His (Active)

Sign In for Pricing
View Details
Goat folic acid (FA) Elisa Kit
EK771068 96 Well

Goat folic acid (FA) Elisa Kit

Sign In for Pricing
View Details
Chicken Immunoglobulin G (IgG) Elisa Kit
EK780141 96 Well

Chicken Immunoglobulin G (IgG) Elisa Kit

Sign In for Pricing
View Details
Human Granzyme A (GZMA) ELISA Kit
DLR-GZMA-Hu-96T 96 Tests

Human Granzyme A (GZMA) ELISA Kit

Sign In for Pricing
View Details