Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli 1,4-dihydroxy-2-naphthoyl-CoA hydrolase (menI)

Product Specifications

Product Name Alternative

(DHNA-CoA hydrolase) (DHNA-CoA thioesterase)

Abbreviation

Recombinant E.coli menI protein

Gene Name

MenI

UniProt

P77781

Expression Region

1-136aa

Organism

Escherichia coli (strain K12)

Target Sequence

MIWKRKITLEALNAMGEGNMVGFLDIRFEHIGDDTLEATMPVDSRTKQPFGLLHGGASVVLAESIGSVAGYLCTEGEQKVVGLEINANHVRSAREGRVRGVCKPLHLGSRHQVWQIEIFDEKGRLCCSSRLTTAIL

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Catalyzes the hydrolysis of 1,4-dihydroxy-2-naphthoyl-CoA (DHNA-CoA) to 1,4-dihydroxy-2-naphthoate (DHNA) . Also shows significant activity toward a wide range of acyl-CoA thioesters, and minimal activity toward benzoyl-holoEntB.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

27.9 kDa

References & Citations

"Identification of a hotdog fold thioesterase involved in the biosynthesis of menaquinone in Escherichia coli." Chen M., Ma X., Chen X., Jiang M., Song H., Guo Z. J. Bacteriol. 195:2768-2775 (2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MANSC Domain Containing Protein 1 (MANSC1) Antibody
abx177455-01 200 µg

MANSC Domain Containing Protein 1 (MANSC1) Antibody

Sign In for Pricing
View Details
MANSC Domain Containing Protein 1 (MANSC1) Antibody
abx177455-02 1 mg

MANSC Domain Containing Protein 1 (MANSC1) Antibody

Sign In for Pricing
View Details
Nuclear Factor I/C (NFIC, CCAAT-binding Transcription Factor, CTF, Nuclear Factor 1 C-Type, CTF5, MGC20153, NF-I, NF1-C, CTF, TGGCA-Binding Protein, NFI) (Biotin)
MBS6143277-01 0.1 mL

Nuclear Factor I/C (NFIC, CCAAT-binding Transcription Factor, CTF, Nuclear Factor 1 C-Type, CTF5, MGC20153, NF-I, NF1-C, CTF, TGGCA-Binding Protein, NFI) (Biotin)

Sign In for Pricing
View Details
Nuclear Factor I/C (NFIC, CCAAT-binding Transcription Factor, CTF, Nuclear Factor 1 C-Type, CTF5, MGC20153, NF-I, NF1-C, CTF, TGGCA-Binding Protein, NFI) (Biotin)
MBS6143277-02 5x 0.1 mL

Nuclear Factor I/C (NFIC, CCAAT-binding Transcription Factor, CTF, Nuclear Factor 1 C-Type, CTF5, MGC20153, NF-I, NF1-C, CTF, TGGCA-Binding Protein, NFI) (Biotin)

Sign In for Pricing
View Details
Tropomyosin 3 (TPM3) (NM_001043353) Human Recombinant Protein
PH34756M5 20 µg

Tropomyosin 3 (TPM3) (NM_001043353) Human Recombinant Protein

Sign In for Pricing
View Details
Smg9 sgRNA CRISPR Lentivector (Rat) (Target 1)
K7615702 1.0 µg DNA

Smg9 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details