Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Prominin-2 (PROM2), partial

Product Specifications

Product Name Alternative

(PROM-2) (Prominin-like protein 2) (hPROML2)

Abbreviation

Recombinant Human PROM2 protein, partial

Gene Name

PROM2

UniProt

Q8N271

Expression Region

27-106aa

Organism

Homo sapiens (Human)

Target Sequence

ATDCKFLGPAEHLTFTPAARARWLAPRVRAPGLLDSLYGTVRRFLSVVQLNPFPSELVKALLNELASVKVNEVVRYEAGY

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.8 kDa

References & Citations

"Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K. Nature 434:724-731 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZMYM4 Antibody
8C19587-AAT 50 µg

ZMYM4 Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Stomach
CS805362 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details
Human S100A12 (S100 Calcium Binding Protein A12) ELISA Kit
E-EL-H6289-01 24 Tests

Human S100A12 (S100 Calcium Binding Protein A12) ELISA Kit

Sign In for Pricing
View Details
Human S100A12 (S100 Calcium Binding Protein A12) ELISA Kit
E-EL-H6289-02 48 Tests

Human S100A12 (S100 Calcium Binding Protein A12) ELISA Kit

Sign In for Pricing
View Details
Human S100A12 (S100 Calcium Binding Protein A12) ELISA Kit
E-EL-H6289-03 96 Tests

Human S100A12 (S100 Calcium Binding Protein A12) ELISA Kit

Sign In for Pricing
View Details
GYPE (NM_002102) Human Over-expression Lysate
LC419538 20 µg

GYPE (NM_002102) Human Over-expression Lysate

Sign In for Pricing
View Details