Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MDK/Midkine, Mouse

Midkine (MDK) is a multifunctional cytokine and growth factor that signals through cell surface proteoglycan and non-proteoglycan receptors. It affects inflammatory responses, cell proliferation, adhesion, survival, tissue regeneration, differentiation and migration. MDK/Midkine Protein, Mouse is the recombinant mouse-derived Midkine protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

MDK/Midkine Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/midkine-protein-mouse.html

Purity

97.00

Smiles

KKKEKVKKGSECSEWTWGPCTPSSKDCGMGFREGTCGAQTQRVHCKVPCNWKKEFGADCKYKFESWGACDGSTGTKARQGTLKKARYNAQCQETIRVTKPCTSKTKSKTKAKKGKGKD

Molecular Formula

17242 (Gene_ID) P12025 (K23-D140) (Accession)

Molecular Weight

Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(S) -Tedizolid 10mg
A14965-10 10 mg

(S) -Tedizolid 10mg

Sign In for Pricing
View Details
Recombinant T-Box Protein 3 (TBX3)
TRV-0011281-01 10 µg

Recombinant T-Box Protein 3 (TBX3)

Sign In for Pricing
View Details
Recombinant T-Box Protein 3 (TBX3)
TRV-0011281-02 50 µg

Recombinant T-Box Protein 3 (TBX3)

Sign In for Pricing
View Details
Recombinant T-Box Protein 3 (TBX3)
TRV-0011281-03 100 µg

Recombinant T-Box Protein 3 (TBX3)

Sign In for Pricing
View Details
Recombinant T-Box Protein 3 (TBX3)
TRV-0011281-04 200 µg

Recombinant T-Box Protein 3 (TBX3)

Sign In for Pricing
View Details
Recombinant T-Box Protein 3 (TBX3)
TRV-0011281-05 500 µg

Recombinant T-Box Protein 3 (TBX3)

Sign In for Pricing
View Details