Question 1

What is the catalog number for Human GPC3 knockdown cell line?

Accepted Answer

The catalog number for Human GPC3 knockdown cell line is ABC-KD6278.

Question 2

What sizes are available for Human GPC3 knockdown cell line?

Accepted Answer

Human GPC3 knockdown cell line is available in the following size(s): 1 Vial.

Question 3

Is Human GPC3 knockdown cell line in stock?

Accepted Answer

Human GPC3 knockdown cell line is currently made to order / not held in immediate stock. Contact us for lead time.

Question 4

Are there any special shipping requirements for Human GPC3 knockdown cell line?

Accepted Answer

Human GPC3 knockdown cell line is requires dry ice shipping.

Question 5

What is Human GPC3 knockdown cell line used for?

Accepted Answer

Human GPC3 knockdown cell line is engineered by our optimized transduction of the specific shRNA with lentivirus. Knockdown levels are determined via qRT-PCR. AcceGen offers generation of stable knockdown (RNAi) cell lines expressing shRNAs targeting genes of your interest.

Question 6

Can this product be used for co-immunoprecipitation (Co-IP)?

Accepted Answer

Suitability for Co-IP depends on the specific antibody and is noted under validated applications on the datasheet. If it isn’t listed, contact our technical support team for guidance based on your target and sample type.

Question 7

Is this kit compatible with automated liquid handling platforms?

Accepted Answer

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.

Question 8

What applications has this product been validated for?

Accepted Answer

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

Human GPC3 knockdown cell line

Product Specifications

Applications

Storage Conditions

Frequently Asked Questions

Explore Other Products

FCRLM1 (N28.1) Alexa Fluor® 546

H-FTLIELLIVVAIIGILAAIAIPQFSAYRVKAYNSAASSDLRNLKTALESAFADDQTYPPES-OH

H-FTLIELLIVVAIIGILAAIAIPQFSAYRVKAYNSAASSDLRNLKTALESAFADDQTYPPES-OH

H-FTLIELLIVVAIIGILAAIAIPQFSAYRVKAYNSAASSDLRNLKTALESAFADDQTYPPES-OH

Il4ra Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

KDM4B siRNA (Human)