Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Kit ligand protein (KITLG), partial (Active)

Product Specifications

Product Name Alternative

Mast cell growth factor, Stem cell factor, SCF, c-Kit ligand

Abbreviation

Recombinant Human KITLG protein, partial (Active)

Gene Name

KITLG

UniProt

P21583

Expression Region

26-189aa

Organism

Homo sapiens (Human)

Target Sequence

EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Immunology

Relevance

Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>97% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 x 105 IU/mg.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 µm filtered PBS, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins.

Molecular Weight

18.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM55A AAV siRNA Pooled Vector
20053161 1.0 µg

FAM55A AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Trim10 (NM_011280) Mouse Recombinant Protein
PM46065M5 20 µg

Trim10 (NM_011280) Mouse Recombinant Protein

Sign In for Pricing
View Details
FZD5-set siRNA/shRNA/RNAi Lentivector (Human)
21112091 4x 500 ng

FZD5-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Gramd4 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4611904 1.0 µg DNA

Gramd4 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Fam162a Mouse shRNA Plasmid (Locus ID 70186)
TL504399 1 Kit

Fam162a Mouse shRNA Plasmid (Locus ID 70186)

Sign In for Pricing
View Details
Serum, Bovine Fetal, Tetracycline Negative (FBS, FCS) discontinued
S1003-15P 500 mL

Serum, Bovine Fetal, Tetracycline Negative (FBS, FCS) discontinued

Sign In for Pricing
View Details