Adenylate Kinase 1/AK1, Rat (His)
The adenylate kinase 1 (AK1) protein plays a crucial role in cellular energy homeostasis by maintaining the balance of adenylate nucleotides by catalyzing the reversible transfer of terminal phosphate groups between ATP and AMP.Adenylate Kinase 1/AK1 Protein, Rat (His) is the recombinant rat-derived Adenylate Kinase 1/AK1 protein, expressed by E.coli , with N-His labeled tag.
Product Specifications
Product Name Alternative
Adenylate Kinase 1/AK1 Protein, Rat (His), Rat, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/adenylate-kinase-1-ak1-protein-rat-his.html
Purity
98.0
Smiles
MEDKLKKAKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSSRGKMLSSIMEKGELVPLETVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEEFERKIAQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVISFYDKRGIVRKVNAEGSVDTVFSQVCTYLDSLK
Molecular Formula
24183 (Gene_ID) P39069 (M1-K194) (Accession)
Molecular Weight
Approximately 23 kDa
Shipping Conditions
Dry ice
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040352-100 1x 100 µL
CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940031-100 1x 100 µL
Mucin 5AC (MUC5AC) (45M1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC140017-500 1x 500 µL
Ep-CAM / CD326 (VU-1D9), CF514 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740723-100 1x 100 µL
P53 (BP53-12 + DO-7), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details