Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Otolin-1, Human (HEK293, His)

Otolin-1 is a collagen-like protein that shows specific expression in the inner ear, where it is a key component that provides the organic scaffolding for the otic bulb (the calcium carbonate structure found in the otic bulb and utricle) . Otolin-1 plays a key role as a scaffold in the biomineralization process by chelating calcium and forming interconnected fibrils between otoliths, thereby integrating into the calcium crystal structure. Otolin-1 Protein, Human (HEK293, His) is the recombinant human-derived Otolin-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Otolin-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/otolin-1-protein-human-hek-293-his.html

Smiles

KTTPHTKFTKKSEEREMPKGLKPSSGPPPEEEETLFTEMAEMAEPITKPSALDSVFGTATLSPFENFTLDPADFFLNCCDCCSPVPGQKGEPGETGQPGPKGEAGNLGIPGPPGVVGPQGPRGYKGEKGLKGERGDQGVPGYPGKPGAQGEPGPKGDKGNIGLGGVKGQKGSKGDTCGNCTKGEKGDQGAMGSPGLHGGPGAKGEKGEMGEKGEMGDKGCCGDSGERGGKGQKGEGGMKGEKGSKGDSGMEGKSGRNGLPGAKGDPGIKGEKGELGPPGLLGPTGPKGDIGNKGVRGPTGKKGSRGFKGSKGELARVPRSAFSAGLSKPFPPPNIPIKFEKILYNDQGNYSPVTGKFNCSIPGTYVFSYHITVRGRPARISLVAQNKKQFKSRETLYGQEIDQASLLVILKLSAGDQVWLEVSKDWNGVYVSAEDDSIFTGFLLYPEETSGISP

Molecular Formula

131149 (Gene_ID) A6NHN0 (K24-P477) (Accession)

Molecular Weight

Approximately 84-94 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

PACT Antibody
E38QA2183 100 µL

PACT Antibody

Sign In for Pricing
View Details
ITLN2 sgRNA CRISPR Lentivector (Human) (Target 1)
K1106802 1.0 µg DNA

ITLN2 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Mouse Glutamate Receptor, Ionotropic, AMPA 4 (GRIA4) ELISA Kit
RD-GRIA4-Mu-96Tests 96 Tests

Mouse Glutamate Receptor, Ionotropic, AMPA 4 (GRIA4) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal EphA4 Antibody
NBP2-16348 0.1 mL

Rabbit Polyclonal EphA4 Antibody

Sign In for Pricing
View Details
Lamin A (LMNA) (NM_001282625) Human Tagged ORF Clone
RG238938 10 µg

Lamin A (LMNA) (NM_001282625) Human Tagged ORF Clone

Sign In for Pricing
View Details
Monkey ATP-sensitive inward rectifier potassium channel 12 (KCNJ12) ELISA Kit
MBS7227539-01 48 Well

Monkey ATP-sensitive inward rectifier potassium channel 12 (KCNJ12) ELISA Kit

Sign In for Pricing
View Details