Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Otolin-1, Human (HEK293, His)

Otolin-1 is a collagen-like protein that shows specific expression in the inner ear, where it is a key component that provides the organic scaffolding for the otic bulb (the calcium carbonate structure found in the otic bulb and utricle) . Otolin-1 plays a key role as a scaffold in the biomineralization process by chelating calcium and forming interconnected fibrils between otoliths, thereby integrating into the calcium crystal structure. Otolin-1 Protein, Human (HEK293, His) is the recombinant human-derived Otolin-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Otolin-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/otolin-1-protein-human-hek-293-his.html

Smiles

KTTPHTKFTKKSEEREMPKGLKPSSGPPPEEEETLFTEMAEMAEPITKPSALDSVFGTATLSPFENFTLDPADFFLNCCDCCSPVPGQKGEPGETGQPGPKGEAGNLGIPGPPGVVGPQGPRGYKGEKGLKGERGDQGVPGYPGKPGAQGEPGPKGDKGNIGLGGVKGQKGSKGDTCGNCTKGEKGDQGAMGSPGLHGGPGAKGEKGEMGEKGEMGDKGCCGDSGERGGKGQKGEGGMKGEKGSKGDSGMEGKSGRNGLPGAKGDPGIKGEKGELGPPGLLGPTGPKGDIGNKGVRGPTGKKGSRGFKGSKGELARVPRSAFSAGLSKPFPPPNIPIKFEKILYNDQGNYSPVTGKFNCSIPGTYVFSYHITVRGRPARISLVAQNKKQFKSRETLYGQEIDQASLLVILKLSAGDQVWLEVSKDWNGVYVSAEDDSIFTGFLLYPEETSGISP

Molecular Formula

131149 (Gene_ID) A6NHN0 (K24-P477) (Accession)

Molecular Weight

Approximately 84-94 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aph1b (NM_001047090) Rat Tagged Lenti ORF Clone
RR206094L4 10 µg

Aph1b (NM_001047090) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Aldh1a7 Protein Vector (Mouse) (pPB-N-His)
PV153751 500 ng

Aldh1a7 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Rat Monoclonal Laminin gamma 1 Antibody (A5) [Alexa Fluor 405]
NBP2-47842AF405 0.1 mL

Rat Monoclonal Laminin gamma 1 Antibody (A5) [Alexa Fluor 405]

Sign In for Pricing
View Details
PDLIM5 (NM_006457) Human Tagged ORF Clone
RC200592 10 µg

PDLIM5 (NM_006457) Human Tagged ORF Clone

Sign In for Pricing
View Details
EXOSC5 (NM_020158) Human Tagged ORF Clone Lentiviral Particle
RC210665L4V 200 µL

EXOSC5 (NM_020158) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PHYHIPL (NM_032439) Human Recombinant Protein
TP303950 20 µg

PHYHIPL (NM_032439) Human Recombinant Protein

Sign In for Pricing
View Details