Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Otolin-1, Human (HEK293, His)

Otolin-1 is a collagen-like protein that shows specific expression in the inner ear, where it is a key component that provides the organic scaffolding for the otic bulb (the calcium carbonate structure found in the otic bulb and utricle) . Otolin-1 plays a key role as a scaffold in the biomineralization process by chelating calcium and forming interconnected fibrils between otoliths, thereby integrating into the calcium crystal structure. Otolin-1 Protein, Human (HEK293, His) is the recombinant human-derived Otolin-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Otolin-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/otolin-1-protein-human-hek-293-his.html

Smiles

KTTPHTKFTKKSEEREMPKGLKPSSGPPPEEEETLFTEMAEMAEPITKPSALDSVFGTATLSPFENFTLDPADFFLNCCDCCSPVPGQKGEPGETGQPGPKGEAGNLGIPGPPGVVGPQGPRGYKGEKGLKGERGDQGVPGYPGKPGAQGEPGPKGDKGNIGLGGVKGQKGSKGDTCGNCTKGEKGDQGAMGSPGLHGGPGAKGEKGEMGEKGEMGDKGCCGDSGERGGKGQKGEGGMKGEKGSKGDSGMEGKSGRNGLPGAKGDPGIKGEKGELGPPGLLGPTGPKGDIGNKGVRGPTGKKGSRGFKGSKGELARVPRSAFSAGLSKPFPPPNIPIKFEKILYNDQGNYSPVTGKFNCSIPGTYVFSYHITVRGRPARISLVAQNKKQFKSRETLYGQEIDQASLLVILKLSAGDQVWLEVSKDWNGVYVSAEDDSIFTGFLLYPEETSGISP

Molecular Formula

131149 (Gene_ID) A6NHN0 (K24-P477) (Accession)

Molecular Weight

Approximately 84-94 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal ASF1b Antibody (128) [mFluor Violet 610 SE]
NBP2-90280MFV610 0.1 mL

Rabbit Monoclonal ASF1b Antibody (128) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Goat anti-TCF1/HNF1 Antibody
MBS420686-01 0.1 mg

Goat anti-TCF1/HNF1 Antibody

Sign In for Pricing
View Details
Goat anti-TCF1/HNF1 Antibody
MBS420686-02 5x 0.1 mg

Goat anti-TCF1/HNF1 Antibody

Sign In for Pricing
View Details
SNAPAP (SNARE-associated Protein Snapin, Biogenesis of Lysosome-related Organelles Complex 1 Subunit 7, BLOC-1 Subunit 7, Synaptosomal-associated Protein 25-binding Protein, SNAP-associated Protein, BLOC1S7, SNAP25BP, SNAPIN) (MaxLight 490)
133610-ML490 100 µL

SNAPAP (SNARE-associated Protein Snapin, Biogenesis of Lysosome-related Organelles Complex 1 Subunit 7, BLOC-1 Subunit 7, Synaptosomal-associated Protein 25-binding Protein, SNAP-associated Protein, BLOC1S7, SNAP25BP, SNAPIN) (MaxLight 490)

Sign In for Pricing
View Details
Anti-RBMXL3 Antibody (R4C08)
RHN99001 100 μg

Anti-RBMXL3 Antibody (R4C08)

Sign In for Pricing
View Details
HOXA11 Antibody
A47344-50UL 50 μL

HOXA11 Antibody

Sign In for Pricing
View Details