Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Otolin-1, Human (HEK293, His)

Otolin-1 is a collagen-like protein that shows specific expression in the inner ear, where it is a key component that provides the organic scaffolding for the otic bulb (the calcium carbonate structure found in the otic bulb and utricle) . Otolin-1 plays a key role as a scaffold in the biomineralization process by chelating calcium and forming interconnected fibrils between otoliths, thereby integrating into the calcium crystal structure. Otolin-1 Protein, Human (HEK293, His) is the recombinant human-derived Otolin-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Otolin-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/otolin-1-protein-human-hek-293-his.html

Smiles

KTTPHTKFTKKSEEREMPKGLKPSSGPPPEEEETLFTEMAEMAEPITKPSALDSVFGTATLSPFENFTLDPADFFLNCCDCCSPVPGQKGEPGETGQPGPKGEAGNLGIPGPPGVVGPQGPRGYKGEKGLKGERGDQGVPGYPGKPGAQGEPGPKGDKGNIGLGGVKGQKGSKGDTCGNCTKGEKGDQGAMGSPGLHGGPGAKGEKGEMGEKGEMGDKGCCGDSGERGGKGQKGEGGMKGEKGSKGDSGMEGKSGRNGLPGAKGDPGIKGEKGELGPPGLLGPTGPKGDIGNKGVRGPTGKKGSRGFKGSKGELARVPRSAFSAGLSKPFPPPNIPIKFEKILYNDQGNYSPVTGKFNCSIPGTYVFSYHITVRGRPARISLVAQNKKQFKSRETLYGQEIDQASLLVILKLSAGDQVWLEVSKDWNGVYVSAEDDSIFTGFLLYPEETSGISP

Molecular Formula

131149 (Gene_ID) A6NHN0 (K24-P477) (Accession)

Molecular Weight

Approximately 84-94 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD62E/CD62P Antibody (FITC)
GWB-4F3AAB 0.1 mg

CD62E/CD62P Antibody (FITC)

Sign In for Pricing
View Details
Tlk2 (NM_001294334) Mouse Tagged ORF Clone
MR230918 10 µg

Tlk2 (NM_001294334) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
TEX13B, CT (TEX13B, Testis-expressed sequence 13B protein) (MaxLight 650) discontinued
042751-ML650 100 µL

TEX13B, CT (TEX13B, Testis-expressed sequence 13B protein) (MaxLight 650) discontinued

Sign In for Pricing
View Details
CD44 FITC
ant-244 0.5mg

CD44 FITC

Sign In for Pricing
View Details
MART-1/Melan-A/MLANA (Melanoma Marker)
MBS439962-01 0.02 mg (With BSA & Azide at 0.2mg/mL)

MART-1/Melan-A/MLANA (Melanoma Marker)

Sign In for Pricing
View Details
MART-1/Melan-A/MLANA (Melanoma Marker)
MBS439962-02 0.1 mg (With BSA & Azide at 0.2mg/mL)

MART-1/Melan-A/MLANA (Melanoma Marker)

Sign In for Pricing
View Details