Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Otolin-1, Human (HEK293, His)

Otolin-1 is a collagen-like protein that shows specific expression in the inner ear, where it is a key component that provides the organic scaffolding for the otic bulb (the calcium carbonate structure found in the otic bulb and utricle) . Otolin-1 plays a key role as a scaffold in the biomineralization process by chelating calcium and forming interconnected fibrils between otoliths, thereby integrating into the calcium crystal structure. Otolin-1 Protein, Human (HEK293, His) is the recombinant human-derived Otolin-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Otolin-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/otolin-1-protein-human-hek-293-his.html

Smiles

KTTPHTKFTKKSEEREMPKGLKPSSGPPPEEEETLFTEMAEMAEPITKPSALDSVFGTATLSPFENFTLDPADFFLNCCDCCSPVPGQKGEPGETGQPGPKGEAGNLGIPGPPGVVGPQGPRGYKGEKGLKGERGDQGVPGYPGKPGAQGEPGPKGDKGNIGLGGVKGQKGSKGDTCGNCTKGEKGDQGAMGSPGLHGGPGAKGEKGEMGEKGEMGDKGCCGDSGERGGKGQKGEGGMKGEKGSKGDSGMEGKSGRNGLPGAKGDPGIKGEKGELGPPGLLGPTGPKGDIGNKGVRGPTGKKGSRGFKGSKGELARVPRSAFSAGLSKPFPPPNIPIKFEKILYNDQGNYSPVTGKFNCSIPGTYVFSYHITVRGRPARISLVAQNKKQFKSRETLYGQEIDQASLLVILKLSAGDQVWLEVSKDWNGVYVSAEDDSIFTGFLLYPEETSGISP

Molecular Formula

131149 (Gene_ID) A6NHN0 (K24-P477) (Accession)

Molecular Weight

Approximately 84-94 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM82A1 Recombinant Protein (Mouse)
RP133622 100 µg

FAM82A1 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Mcpt1 (NM_017145) Rat Tagged ORF Clone Lentiviral Particle
RR207961L3V 200 µL

Mcpt1 (NM_017145) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
LIMK-1/2 (phospho Thr508/505) Rabbit Polyclonal Antibody
E28PP0591 100 µL

LIMK-1/2 (phospho Thr508/505) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Mt4 shRNA (UAS) - Lentiviral mouse Mt4 shRNA (UAS, RFP) (100)
GTR15235836 1 Vial

Lentiviral mouse Mt4 shRNA (UAS) - Lentiviral mouse Mt4 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
PHOX2B, ID (PHOX2B, PMX2B, Paired mesoderm homeobox protein 2B, Neuroblastoma Phox, PHOX2B homeodomain protein, Paired-like homeobox 2B) (MaxLight 490)
MBS6333470-01 0.1 mL

PHOX2B, ID (PHOX2B, PMX2B, Paired mesoderm homeobox protein 2B, Neuroblastoma Phox, PHOX2B homeodomain protein, Paired-like homeobox 2B) (MaxLight 490)

Sign In for Pricing
View Details
PHOX2B, ID (PHOX2B, PMX2B, Paired mesoderm homeobox protein 2B, Neuroblastoma Phox, PHOX2B homeodomain protein, Paired-like homeobox 2B) (MaxLight 490)
MBS6333470-02 5x 0.1 mL

PHOX2B, ID (PHOX2B, PMX2B, Paired mesoderm homeobox protein 2B, Neuroblastoma Phox, PHOX2B homeodomain protein, Paired-like homeobox 2B) (MaxLight 490)

Sign In for Pricing
View Details