Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Otolin-1, Human (HEK293, His)

Otolin-1 is a collagen-like protein that shows specific expression in the inner ear, where it is a key component that provides the organic scaffolding for the otic bulb (the calcium carbonate structure found in the otic bulb and utricle) . Otolin-1 plays a key role as a scaffold in the biomineralization process by chelating calcium and forming interconnected fibrils between otoliths, thereby integrating into the calcium crystal structure. Otolin-1 Protein, Human (HEK293, His) is the recombinant human-derived Otolin-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Otolin-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/otolin-1-protein-human-hek-293-his.html

Smiles

KTTPHTKFTKKSEEREMPKGLKPSSGPPPEEEETLFTEMAEMAEPITKPSALDSVFGTATLSPFENFTLDPADFFLNCCDCCSPVPGQKGEPGETGQPGPKGEAGNLGIPGPPGVVGPQGPRGYKGEKGLKGERGDQGVPGYPGKPGAQGEPGPKGDKGNIGLGGVKGQKGSKGDTCGNCTKGEKGDQGAMGSPGLHGGPGAKGEKGEMGEKGEMGDKGCCGDSGERGGKGQKGEGGMKGEKGSKGDSGMEGKSGRNGLPGAKGDPGIKGEKGELGPPGLLGPTGPKGDIGNKGVRGPTGKKGSRGFKGSKGELARVPRSAFSAGLSKPFPPPNIPIKFEKILYNDQGNYSPVTGKFNCSIPGTYVFSYHITVRGRPARISLVAQNKKQFKSRETLYGQEIDQASLLVILKLSAGDQVWLEVSKDWNGVYVSAEDDSIFTGFLLYPEETSGISP

Molecular Formula

131149 (Gene_ID) A6NHN0 (K24-P477) (Accession)

Molecular Weight

Approximately 84-94 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-SMC1  (Ser957)  Antibody
ABF3439 100 µg

Phospho-SMC1 (Ser957) Antibody

Sign In for Pricing
View Details
Debio-1347
MBS130713-01 100 mg

Debio-1347

Sign In for Pricing
View Details
Debio-1347
MBS130713-02 500 mg

Debio-1347

Sign In for Pricing
View Details
Human USP22 Knockout A549 cell line
GTR15416945 1 Vial

Human USP22 Knockout A549 cell line

Sign In for Pricing
View Details
EPPTB, TAAR1 antagonist
TBI1199-10MG 10 mg

EPPTB, TAAR1 antagonist

Sign In for Pricing
View Details
(1R,1’R, 2’S) -2-Desmethyl Cisatracurium Besylate
412457-01 1 mg

(1R,1’R, 2’S) -2-Desmethyl Cisatracurium Besylate

Sign In for Pricing
View Details