Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Otolin-1, Human (HEK293, His)

Otolin-1 is a collagen-like protein that shows specific expression in the inner ear, where it is a key component that provides the organic scaffolding for the otic bulb (the calcium carbonate structure found in the otic bulb and utricle) . Otolin-1 plays a key role as a scaffold in the biomineralization process by chelating calcium and forming interconnected fibrils between otoliths, thereby integrating into the calcium crystal structure. Otolin-1 Protein, Human (HEK293, His) is the recombinant human-derived Otolin-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Otolin-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/otolin-1-protein-human-hek-293-his.html

Smiles

KTTPHTKFTKKSEEREMPKGLKPSSGPPPEEEETLFTEMAEMAEPITKPSALDSVFGTATLSPFENFTLDPADFFLNCCDCCSPVPGQKGEPGETGQPGPKGEAGNLGIPGPPGVVGPQGPRGYKGEKGLKGERGDQGVPGYPGKPGAQGEPGPKGDKGNIGLGGVKGQKGSKGDTCGNCTKGEKGDQGAMGSPGLHGGPGAKGEKGEMGEKGEMGDKGCCGDSGERGGKGQKGEGGMKGEKGSKGDSGMEGKSGRNGLPGAKGDPGIKGEKGELGPPGLLGPTGPKGDIGNKGVRGPTGKKGSRGFKGSKGELARVPRSAFSAGLSKPFPPPNIPIKFEKILYNDQGNYSPVTGKFNCSIPGTYVFSYHITVRGRPARISLVAQNKKQFKSRETLYGQEIDQASLLVILKLSAGDQVWLEVSKDWNGVYVSAEDDSIFTGFLLYPEETSGISP

Molecular Formula

131149 (Gene_ID) A6NHN0 (K24-P477) (Accession)

Molecular Weight

Approximately 84-94 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human EIF2AK4 shRNA (UAS) - Lentiviral human EIF2AK4 shRNA (UAS, RFP) (25)
GTR15077987 1 Vial

Lentiviral human EIF2AK4 shRNA (UAS) - Lentiviral human EIF2AK4 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Recombinant Bordetella petrii UPF0060 membrane protein Bpet0062 (Bpet0062), partial
MBS7066290 Inquire

Recombinant Bordetella petrii UPF0060 membrane protein Bpet0062 (Bpet0062), partial

Sign In for Pricing
View Details
Histone H2A.Z Rabbit pAb
MBS8541901-01 0.1 mL

Histone H2A.Z Rabbit pAb

Sign In for Pricing
View Details
Histone H2A.Z Rabbit pAb
MBS8541901-02 0.1 mL (AF405L)

Histone H2A.Z Rabbit pAb

Sign In for Pricing
View Details
Histone H2A.Z Rabbit pAb
MBS8541901-03 0.1 mL (AF405S)

Histone H2A.Z Rabbit pAb

Sign In for Pricing
View Details
Histone H2A.Z Rabbit pAb
MBS8541901-04 0.1 mL (AF610)

Histone H2A.Z Rabbit pAb

Sign In for Pricing
View Details