Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cytochrome b5/CYB5A, Human (His)

Cytochrome b5 (CYB5A) is a vital membrane-bound hemoprotein acting as an electron carrier for diverse membrane-bound oxygenases. Positioned in cellular membranes, it crucially facilitates electron transfer processes, supporting the activity of oxygenase enzymes. CYB5A's role as an electron carrier highlights its significance in cellular redox reactions and metabolic pathways involving oxygenases. Cytochrome b5/CYB5A Protein, Human (His) is the recombinant human-derived Cytochrome b5/CYB5A protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Cytochrome b5/CYB5A Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cytochrome-b5-cyb5a-protein-human-his.html

Purity

91.60

Smiles

MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISAVAVALMYRLYMAED

Molecular Formula

1528 (Gene_ID) P00167 (M1-D134) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Synechococcus sp. tRNA modification GTPase MnmE (mnmE)
MBS1455867-01 0.02 mg (E-Coli)

Recombinant Synechococcus sp. tRNA modification GTPase MnmE (mnmE)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. tRNA modification GTPase MnmE (mnmE)
MBS1455867-02 0.02 mg (Yeast)

Recombinant Synechococcus sp. tRNA modification GTPase MnmE (mnmE)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. tRNA modification GTPase MnmE (mnmE)
MBS1455867-03 0.1 mg (E-Coli)

Recombinant Synechococcus sp. tRNA modification GTPase MnmE (mnmE)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. tRNA modification GTPase MnmE (mnmE)
MBS1455867-04 0.1 mg (Yeast)

Recombinant Synechococcus sp. tRNA modification GTPase MnmE (mnmE)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. tRNA modification GTPase MnmE (mnmE)
MBS1455867-05 0.02 mg (Baculovirus)

Recombinant Synechococcus sp. tRNA modification GTPase MnmE (mnmE)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. tRNA modification GTPase MnmE (mnmE)
MBS1455867-06 0.02 mg (Mammalian-Cell)

Recombinant Synechococcus sp. tRNA modification GTPase MnmE (mnmE)

Sign In for Pricing
View Details