Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIST3H2A, Human

The HIST3H2A protein is a core component of nucleosomes that compact DNA into chromatin. HIST3H2A Protein, Human is the recombinant human-derived HIST3H2A protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

HIST3H2A Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hist3h2a-protein-human.html

Purity

95.00

Smiles

SGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK

Molecular Formula

92815 (Gene_ID) Q7L7L0 (S2-K130) (Accession)

Molecular Weight

15-20 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAD51L3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1779707 1.0 µg DNA

RAD51L3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Mouse Anti-Sheep MHC Class I Monoclonal Antibody
VD11N734 1 Each

Mouse Anti-Sheep MHC Class I Monoclonal Antibody

Sign In for Pricing
View Details
CRYAB (Crystallin, alpha B, CRYA2, CTPP2, HSPB5)
244947 50 µL

CRYAB (Crystallin, alpha B, CRYA2, CTPP2, HSPB5)

Sign In for Pricing
View Details
Rabbit Monoclonal WNK1 Antibody (6C5S6)
NBP3-16360-20ul 20 µL

Rabbit Monoclonal WNK1 Antibody (6C5S6)

Sign In for Pricing
View Details
Immt (NM_001253688) Mouse Untagged Clone
MC228649 10 µg

Immt (NM_001253688) Mouse Untagged Clone

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) SDH2-1 Polyclonal Antibody
MBS9002691 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) SDH2-1 Polyclonal Antibody

Sign In for Pricing
View Details