HIST3H2A, Human
The HIST3H2A protein is a core component of nucleosomes that compact DNA into chromatin. HIST3H2A Protein, Human is the recombinant human-derived HIST3H2A protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
HIST3H2A Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/hist3h2a-protein-human.html
Purity
95.00
Smiles
SGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
Molecular Formula
92815 (Gene_ID) Q7L7L0 (S2-K130) (Accession)
Molecular Weight
15-20 kDa.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MR226603L4V 200 µL
Pld2 (NM_008876) Mouse Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details bsm-62789R-PE-Cy7 100 µL
GM-CSFR alpha Recombinant Antibody, PE-Cy7 Conjugated
Sign In for Pricing
View Details 
GTR15120723 1 Vial
Lentiviral human PIPOX shRNA (UAS) - Lentiviral human PIPOX shRNA (UAS, iRFP) (100)
Sign In for Pricing
View Details abx585378-01 96 Tests
Monkey Muellerian-Inhibiting Factor (AMH) ELISA Kit
Sign In for Pricing
View Details