HIST3H2A, Human
The HIST3H2A protein is a core component of nucleosomes that compact DNA into chromatin. HIST3H2A Protein, Human is the recombinant human-derived HIST3H2A protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
HIST3H2A Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/hist3h2a-protein-human.html
Purity
95.00
Smiles
SGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
Molecular Formula
92815 (Gene_ID) Q7L7L0 (S2-K130) (Accession)
Molecular Weight
15-20 kDa.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
abx318300-01 20 µg
Mediator of RNA Polymerase II Transcription Subunit 7 (MED7) Antibody
Sign In for Pricing
View Details 
abx318300-02 50 µg
Mediator of RNA Polymerase II Transcription Subunit 7 (MED7) Antibody
Sign In for Pricing
View Details 
abx318300-03 100 µg
Mediator of RNA Polymerase II Transcription Subunit 7 (MED7) Antibody
Sign In for Pricing
View Details 
abx318300-04 200 µg
Mediator of RNA Polymerase II Transcription Subunit 7 (MED7) Antibody
Sign In for Pricing
View Details abx318300-05 1 mg
Mediator of RNA Polymerase II Transcription Subunit 7 (MED7) Antibody
Sign In for Pricing
View Details GTR15362526 1 Vial
Lentiviral human IQGAP3 sgRNA gene knockout kit - Lentiviral human IQGAP3 sgRNA gene knockout kit (25)
Sign In for Pricing
View Details