Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Glucagon-like peptide 1 receptor (Glp1r), partial (Active)

Product Specifications

Product Name Alternative

Glucagon-like peptide 1 receptor; GLP-1 receptor; GLP-1-R; GLP-1R; Glp1r

Abbreviation

Recombinant Mouse Glp1r protein, partial (Active)

Gene Name

Glp1r

UniProt

O35659

Expression Region

22-145aa

Organism

Mus musculus (Mouse)

Target Sequence

GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLY

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Neuroscience

Relevance

G-protein coupled receptor for glucagon-like peptide 1 (GLP-1) . Ligand binding triggers activation of a signaling cascade that leads to the activation of adenylyl cyclase and increased intracellular cAMP levels. Plays a role in regulating insulin secretion in response to GLP-1. Selective recognition of glucagon-like peptide over glucagon is determined by residues located at the C-terminal end of the glucagon-like peptide.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Mouse Glp1r at 2 μg/mL can bind Anti-GLP1R recombinant antibody (CSB-RA009514MA3HU) . The EC50 is 141.7-172.4 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

15.8 kDa

References & Citations

A vagal reflex evoked by airway closure. Schappe M.S., Brinn P.A., Joshi N.R., Greenberg R.S., Min S., Alabi A.A., Zhang C., Liberles S.D. Nature 627:830-838 (2024)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Optional single channel adapter, extra long (80mm) stainless steel
V1002-1SL 1 Each

Optional single channel adapter, extra long (80mm) stainless steel

Sign In for Pricing
View Details
CTXN3 Human Gene Knockout Kit (CRISPR)
KN415242 1 Kit

CTXN3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AKAP12 Polyclonal Antibody
E-AB-12884-01 20 µL

AKAP12 Polyclonal Antibody

Sign In for Pricing
View Details
AKAP12 Polyclonal Antibody
E-AB-12884-02 60 µL

AKAP12 Polyclonal Antibody

Sign In for Pricing
View Details
AKAP12 Polyclonal Antibody
E-AB-12884-03 120 µL

AKAP12 Polyclonal Antibody

Sign In for Pricing
View Details
AKAP12 Polyclonal Antibody
E-AB-12884-04 200 µL

AKAP12 Polyclonal Antibody

Sign In for Pricing
View Details