Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Infectious bronchitis virus Spike glycoprotein S1 subunit (S1), partial

Product Specifications

Abbreviation

Recombinant Infectious bronchitis virus S1 protein, partial

Gene Name

S1

UniProt

D9IAI3

Expression Region

231-539aa

Organism

Infectious bronchitis virus

Target Sequence

ACQYNTGNFSDGFYPFTNVSLVKERFVVYRETSVNTTLVLTNFTFTNVSNASPNTGGVNTINIYQTQTAQSGYYNFNFSFLSSFVYKQSDFMYGSYHPKCDFRPETINNGLWFNSLSVSLAYGPLQGGCKQSVFSNRATCCYAYSYNGPRLCKGVYIGELPQYFECGLLVYVIKSDGSRIQTRNEPLVLTHYNYNNITLDRCVEYNIYGRSGQGFIINVTASAANYNYLADGGLAILDTSGAIDIFVVQGEYGPNYYKVNPCEDVNQQFVVSGGGIVGVLTSHNETGSQQLENRFYVKLTNSTRRTRRL

Tag

N-terminal 6xHis-B2M-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

49.2 kDa

References & Citations

"Characterization of a live attenuated infectious bronchitis virus vaccine candidate derived from the Israeli isolate IS/1494/06." Meir R., Simanov L. Submitted (APR-2010)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SYVN1 activation kit by CRISPRa
GA113552 1 Kit

Human SYVN1 activation kit by CRISPRa

Sign In for Pricing
View Details
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rKi-1/779), CF405S conjugate, 0.1mg/mL
BNC041828-500 1x 500 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rKi-1/779), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FAM177B (NM_207468) Human Over-expression Lysate
LY404043 100 µg

FAM177B (NM_207468) Human Over-expression Lysate

Sign In for Pricing
View Details
Catip Mouse Gene Knockout Kit (CRISPR)
KN502580 1 Kit

Catip Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human NCKAP1 activation kit by CRISPRa
GA107392 1 Kit

Human NCKAP1 activation kit by CRISPRa

Sign In for Pricing
View Details
Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL
BNC040029-100 1x 100 µL

Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details