Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD8 alpha, Mouse (HEK293, His)

CD8A is an important immune glycoprotein that acts as a coreceptor for class I MHC:peptide complexes, linking T cells to antigens presented by APCs. It interacts with TCR and MHC class I, recruits LCK kinase, and initiates multiple signaling pathways. CD8 alpha Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD8 alpha protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD8 alpha Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd8-alpha-protein-mouse-196a-a-hek293-his.html

Purity

98.0

Smiles

KPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIY

Molecular Formula

12525 (Gene_ID) P01731/NP_001074579.1 (K28-Y196) (Accession)

Molecular Weight

The protein migrates as 27-35 kDa under reducing SDS-PAGE due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGEC3 (NM_177456) Human Tagged ORF Clone
RC222612 10 µg

MAGEC3 (NM_177456) Human Tagged ORF Clone

Sign In for Pricing
View Details
Nuclear Transcription Factor Y subunit β (NFYB) Horse ELISA Kit
F4806 96 Tests

Nuclear Transcription Factor Y subunit β (NFYB) Horse ELISA Kit

Sign In for Pricing
View Details
RPS15AP32 3'UTR Lenti-reporter-Luc Vector
42131081 1.0 µg

RPS15AP32 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Von Hippel Lindau monoclonal antibody
MB66032-01 50 µL

Von Hippel Lindau monoclonal antibody

Sign In for Pricing
View Details
Von Hippel Lindau monoclonal antibody
MB66032-02 100 µL

Von Hippel Lindau monoclonal antibody

Sign In for Pricing
View Details
Recombinant Citrobacter koseri UPF0299 membrane protein CKO_00648 (CKO_00648)
orb2921462-01 20 µg

Recombinant Citrobacter koseri UPF0299 membrane protein CKO_00648 (CKO_00648)

Sign In for Pricing
View Details