Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASAM/CLMP, Mouse (HEK293, His)

ASAM/CLMP protein potentially participates in cell-cell adhesion, suggesting a role in adipocyte differentiation and obesity development. It is crucial for normal small intestine development, paralleling functions of related proteins. ASAM/CLMP Protein, Mouse (HEK293, His) is the recombinant mouse-derived ASAM/CLMP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

ASAM/CLMP Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/asam-clmp-protein-mouse-hek293-his.html

Purity

95.00

Smiles

THTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRHVYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELEGEPTEGSDLTLQCESASGTKPIVYYWQRIREKEGEDEHLPPKSRIDYNNPGRVLLQNLTMASSGLYQCTAGNEAGKESCVVRVTVQYVQSIGM

Molecular Formula

71566 (Gene_ID) Q8R373 (T18-M232) (Accession)

Molecular Weight

The protein migrates as approximately 30-35 kDa under reducing SDS-PAGE due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Lecithin Cholesterol Acyltransferase (Lcat) Elisa Kit
EKC39327 96 Tests

Rat Lecithin Cholesterol Acyltransferase (Lcat) Elisa Kit

Sign In for Pricing
View Details
GNL3 Antibody - N-terminal region : Biotin (ARP58826_P050-Biotin)
ARP58826_P050-Biotin 100 µL

GNL3 Antibody - N-terminal region : Biotin (ARP58826_P050-Biotin)

Sign In for Pricing
View Details
Camel Radixin (RDX) ELISA Kit
MBS9904740-01 48 Well

Camel Radixin (RDX) ELISA Kit

Sign In for Pricing
View Details
Camel Radixin (RDX) ELISA Kit
MBS9904740-02 96 Well

Camel Radixin (RDX) ELISA Kit

Sign In for Pricing
View Details
Camel Radixin (RDX) ELISA Kit
MBS9904740-03 5x 96 Well

Camel Radixin (RDX) ELISA Kit

Sign In for Pricing
View Details
Camel Radixin (RDX) ELISA Kit
MBS9904740-04 10x 96 Well

Camel Radixin (RDX) ELISA Kit

Sign In for Pricing
View Details