Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-1, Human (HEK293, His, solution)

The MMP-1 protein acts as an enzyme capable of cleaving types I, II, and III collagen at specific sites within the helical domain. In addition, it exhibits lytic activity against type VII and type X collagen. MMP-1 Protein, Human (HEK293, His, solution) is the recombinant human-derived MMP-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MMP-1 Protein, Human (HEK293, His, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/interstitial-collagenase-mmp-1-protein-human-hek-293-his.html

Purity

99.87

Smiles

FPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN

Molecular Formula

4312 (Gene_ID) P03956 (F20-N469) (Accession)

Molecular Weight

49-61 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mix-n-StainTM CF®647 Nanobody Thiol Labeling Kit, 1x (5-20ug) labeling
#92593 1 Kit

Mix-n-StainTM CF®647 Nanobody Thiol Labeling Kit, 1x (5-20ug) labeling

Sign In for Pricing
View Details
TTF1 (NKX2-1) Mouse Monoclonal Antibody [Clone ID: OTI7E8]
CF813358 100 µg

TTF1 (NKX2-1) Mouse Monoclonal Antibody [Clone ID: OTI7E8]

Sign In for Pricing
View Details
CoverGripTM Coverslip Sealant Refill
#23005-1 1x 100 mL

CoverGripTM Coverslip Sealant Refill

Sign In for Pricing
View Details
MTMR12 (NM_001040446) Human Recombinant Protein
TP314077M 100 µg

MTMR12 (NM_001040446) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS701557 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
DPPH Free Radical Scavenging Capacity Colorimetric Assay Kit
E-BC-K807-M 96 T (40 samples)

DPPH Free Radical Scavenging Capacity Colorimetric Assay Kit

Sign In for Pricing
View Details