Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-1, Human (HEK293, His, solution)

The MMP-1 protein acts as an enzyme capable of cleaving types I, II, and III collagen at specific sites within the helical domain. In addition, it exhibits lytic activity against type VII and type X collagen. MMP-1 Protein, Human (HEK293, His, solution) is the recombinant human-derived MMP-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MMP-1 Protein, Human (HEK293, His, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/interstitial-collagenase-mmp-1-protein-human-hek-293-his.html

Purity

99.87

Smiles

FPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN

Molecular Formula

4312 (Gene_ID) P03956 (F20-N469) (Accession)

Molecular Weight

49-61 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Progesterone Receptor Antibody
KC-806-01 50 μL

Progesterone Receptor Antibody

Sign In for Pricing
View Details
Progesterone Receptor Antibody
KC-806-02 100 µL

Progesterone Receptor Antibody

Sign In for Pricing
View Details
Progesterone Receptor Antibody
KC-806-03 1 mL

Progesterone Receptor Antibody

Sign In for Pricing
View Details
GIPC1 Antibody
orb1247968 0.1 mg

GIPC1 Antibody

Sign In for Pricing
View Details
SIRT1 Rabbit Polyclonal Antibody (PE-Cy5)
orb973170 100 µL

SIRT1 Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
Juniper camphor
HY-N12039 1 Each

Juniper camphor

Sign In for Pricing
View Details