Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANTES/CCL5, Rat (His)

RANTES/CCL5 Protein, Rat (His) is a key pro-inflammatory chemokine in the CC chemokine family that interacts with CCR1, CCR3, CCR4, and CCR5 to mediate inflammatory immune responses, viral infections, and tumorigenesis. RANTES/CCL5 Protein, Rat (His) is a recombinant rat RANTES/CCL5 (S25-S92) protein expressed by E. coli with a His tag at the C-terminu[1].

Product Specifications

Product Name Alternative

RANTES/CCL5 Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccl5-protein-rat-his.html

Purity

95.0

Smiles

HHHHHHSPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS

Molecular Formula

81780 (Gene_ID) P50231 (S25-S92) (Accession)

Molecular Weight

Approximately 14 kDa

References & Citations

[1]Rafael Elias Marques, et al. Targeting CCL5 in inflammation.|[2]Lili Chen, et al. Deletion of C-C Motif Chemokine Ligand 5 Worsens Invariant Natural Killer T-Cell-Mediated Hepatitis via Compensatory Up-regulation of CXCR2-Related Chemokine Activity. Cell Mol Gastroenterol Hepatol. 2019;7 (3) :623-639.|[3]V Appay, et al. RANTES: a versatile and controversial chemokine. Trends Immunol. 2001 Feb;22 (2) :83-7.|[4]Zhen Zeng, et al. CCL5/CCR5 axis in human diseases and related treatments. Genes Dis. 2022 Jan;9 (1) :12-27.|[5]F Cocchi, et al. Identification of RANTES, MIP-1 alpha, and MIP-1 beta as the major HIV-suppressive factors produced by CD8+ T cells. Science. 1995 Dec 15;270 (5243) :1811-5.|[6]Nahzli Dilek, et al. Control of transplant tolerance and intragraft regulatory T cell localization by myeloid-derived suppressor cells and CCL5. J Immunol. 2012 May 1;188 (9) :4209-16.|[7]Khalid Benamar, et al. Elevated level of the proinflammatory chemokine, RANTES/CCL5, in the periaqueductal grey causes hyperalgesia in rats. Eur J Pharmacol. 2008 Sep 11;592 (1-3) :93-5.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone Acetyltransferase 1 (HAT1) Antibody
abx176856-01 200 µg

Histone Acetyltransferase 1 (HAT1) Antibody

Sign In for Pricing
View Details
Histone Acetyltransferase 1 (HAT1) Antibody
abx176856-02 1 mg

Histone Acetyltransferase 1 (HAT1) Antibody

Sign In for Pricing
View Details
CHO Monoclonal Proprotein Convertase 9/PCSK9 Antibody (tafolecimab) - IgG2SA - (Dry Ice)
NBP3-28096-1mg 1 mg

CHO Monoclonal Proprotein Convertase 9/PCSK9 Antibody (tafolecimab) - IgG2SA - (Dry Ice)

Sign In for Pricing
View Details
TRC40 Recombinant Rabbit mAb
orb2322998-01 25 µL

TRC40 Recombinant Rabbit mAb

Sign In for Pricing
View Details
TRC40 Recombinant Rabbit mAb
orb2322998-02 50 µL

TRC40 Recombinant Rabbit mAb

Sign In for Pricing
View Details
TRC40 Recombinant Rabbit mAb
orb2322998-03 100 µL

TRC40 Recombinant Rabbit mAb

Sign In for Pricing
View Details