Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Erythropoietin receptor (EPOR), partial

Product Specifications

Product Name Alternative

(EPO-R)

Abbreviation

Recombinant Human EPOR protein, partial

Gene Name

EPOR

UniProt

P19235

Expression Region

25-250aa

Organism

Homo sapiens (Human)

Target Sequence

APPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDP

Tag

C-terminal 10xHis-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Cardiovascular

Relevance

Receptor for erythropoietin. Mediates erythropoietin-induced erythroblast proliferation and differentiation. Upon EPO stimulation, EPOR dimerizes triggering the JAK2/STAT5 signaling cascade. In some cell types, can also activate STAT1 and STAT3. May also activate the LYN tyrosine kinase.; Isoform EPOR-T acts as a dominant-negative receptor of EPOR-mediated signaling.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

27.6 kDa

References & Citations

"Efficiency of signalling through cytokine receptors depends critically on receptor orientation." Syed RS, Reid SW, Li C, Cheetham JC, Aoki KH, Liu B, Zhan H, Osslund TD, Chirino AJ, Zhang J, Finer-Moore J, Elliott S, Sitney K, Katz BA, Matthews DJ, Wendoloski JJ, Egrie J, Stroud RM. Nature 395 511-6 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Streptavidin, CF®405L Conjugate
#29056 1x 1 mg

Streptavidin, CF®405L Conjugate

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) Mouse Monoclonal Antibody [Clone ID: K8.8 + DC10]
AM50261PU-S 100 µg

Cytokeratin 8 (KRT8) Mouse Monoclonal Antibody [Clone ID: K8.8 + DC10]

Sign In for Pricing
View Details
WNT9B (NM_003396) Human Over-expression Lysate
LC401159 20 µg

WNT9B (NM_003396) Human Over-expression Lysate

Sign In for Pricing
View Details
5-Acetamidonaphthalene-1-sulfonyl Chloride
TRC-A158465-5G 5 g

5-Acetamidonaphthalene-1-sulfonyl Chloride

Sign In for Pricing
View Details
KHDC1 Mouse Monoclonal Antibody [Clone ID: OTI2G6]
CF810622 100 µg

KHDC1 Mouse Monoclonal Antibody [Clone ID: OTI2G6]

Sign In for Pricing
View Details
Lair1 Mouse Gene Knockout Kit (CRISPR)
KN309105BN 1 Kit

Lair1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details