Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin L2, Human (HEK293, His, solution)

Cathepsin L2 is a cysteine protease thought to play a crucial role in corneal physiology, but its specific function and mechanism are still under investigation. The unique properties of cathepsin L2 suggest that it may be involved in important cellular and molecular events within the cornea, underscoring its importance in maintaining ocular tissue health. Cathepsin L2 Protein, Human (HEK293, His, solution) is the recombinant human-derived Cathepsin L2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Cathepsin L2 Protein, Human (HEK293, His, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-l2-protein-human-hek293-his-solution.html

Purity

98.0

Smiles

VPKFDQNLDTKWYQWKATHRRLYGANEEGWRRAVWEKNMKMIELHNGEYSQGKHGFTMAMNAFGDMTNEEFRQMMGCFRNQKFRKGKVFREPLFLDLPKSVDWRKKGYVTPVKNQKQCGSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPYVAVDEICKYRPENSVANDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLDHGVLVVGYGFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIATAASYPNVHHHHHH

Molecular Formula

1515 (Gene_ID) O60911 (V18-V334) (Accession)

Molecular Weight

Approximately 33-38 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bile Salts Agar
M739S-500G 500 g

Bile Salts Agar

Sign In for Pricing
View Details
Protein PrgJ, Recombinant, Salmonella typhimurium, aa1-101, His-SUMOSTAR-Tag
586012-01 20 µg

Protein PrgJ, Recombinant, Salmonella typhimurium, aa1-101, His-SUMOSTAR-Tag

Sign In for Pricing
View Details
Protein PrgJ, Recombinant, Salmonella typhimurium, aa1-101, His-SUMOSTAR-Tag
586012-02 100 µg

Protein PrgJ, Recombinant, Salmonella typhimurium, aa1-101, His-SUMOSTAR-Tag

Sign In for Pricing
View Details
Dihydrosphingosine, D-erythro
BML-SL125-0010 10 mg

Dihydrosphingosine, D-erythro

Sign In for Pricing
View Details
HYDIN shRNA (m) Lentiviral Particles
sc-146119-V 200 µL

HYDIN shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Anacardic acid
044500-01 5 mg

Anacardic acid

Sign In for Pricing
View Details