Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin L2, Human (HEK293, His, solution)

Cathepsin L2 is a cysteine protease thought to play a crucial role in corneal physiology, but its specific function and mechanism are still under investigation. The unique properties of cathepsin L2 suggest that it may be involved in important cellular and molecular events within the cornea, underscoring its importance in maintaining ocular tissue health. Cathepsin L2 Protein, Human (HEK293, His, solution) is the recombinant human-derived Cathepsin L2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Cathepsin L2 Protein, Human (HEK293, His, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-l2-protein-human-hek293-his-solution.html

Purity

98.0

Smiles

VPKFDQNLDTKWYQWKATHRRLYGANEEGWRRAVWEKNMKMIELHNGEYSQGKHGFTMAMNAFGDMTNEEFRQMMGCFRNQKFRKGKVFREPLFLDLPKSVDWRKKGYVTPVKNQKQCGSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPYVAVDEICKYRPENSVANDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLDHGVLVVGYGFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIATAASYPNVHHHHHH

Molecular Formula

1515 (Gene_ID) O60911 (V18-V334) (Accession)

Molecular Weight

Approximately 33-38 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(E)-5-Octadec-5-ene
TRC-O273075-1G 1 g

(E)-5-Octadec-5-ene

Sign In for Pricing
View Details
IGKV2-23 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1055408 1.0 µg DNA

IGKV2-23 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Anti-ISLR Polyclonal Antibody
HT108014-01 50 µg

Anti-ISLR Polyclonal Antibody

Sign In for Pricing
View Details
Anti-ISLR Polyclonal Antibody
HT108014-02 100 µg

Anti-ISLR Polyclonal Antibody

Sign In for Pricing
View Details
Hsa-miR-296-5p miRNA Agomir
orb1921408-01 5 nmol

Hsa-miR-296-5p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-296-5p miRNA Agomir
orb1921408-02 10 nmol

Hsa-miR-296-5p miRNA Agomir

Sign In for Pricing
View Details