Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin L2, Human (HEK293, His, solution)

Cathepsin L2 is a cysteine protease thought to play a crucial role in corneal physiology, but its specific function and mechanism are still under investigation. The unique properties of cathepsin L2 suggest that it may be involved in important cellular and molecular events within the cornea, underscoring its importance in maintaining ocular tissue health. Cathepsin L2 Protein, Human (HEK293, His, solution) is the recombinant human-derived Cathepsin L2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Cathepsin L2 Protein, Human (HEK293, His, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-l2-protein-human-hek293-his-solution.html

Purity

98.0

Smiles

VPKFDQNLDTKWYQWKATHRRLYGANEEGWRRAVWEKNMKMIELHNGEYSQGKHGFTMAMNAFGDMTNEEFRQMMGCFRNQKFRKGKVFREPLFLDLPKSVDWRKKGYVTPVKNQKQCGSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPYVAVDEICKYRPENSVANDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLDHGVLVVGYGFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIATAASYPNVHHHHHH

Molecular Formula

1515 (Gene_ID) O60911 (V18-V334) (Accession)

Molecular Weight

Approximately 33-38 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIF1AN Recombinant Antibody, PE-Cy5 Conjugated
bsm-61905R-PE-Cy5 100 µL

HIF1AN Recombinant Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
C-myc epitope tag Recombinant Antibody [9E10] (OAAV00010)
OAAV00510-200UG 200 µg

C-myc epitope tag Recombinant Antibody [9E10] (OAAV00010)

Sign In for Pricing
View Details
Rabbit Polyclonal ALMS1 Antibody [mFluor Violet 610 SE]
NBP3-06330MFV610 0.1 mL

Rabbit Polyclonal ALMS1 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Cdkl3 (NM_001166657) Mouse Tagged Lenti ORF Clone
MR205374L4 10 µg

Cdkl3 (NM_001166657) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
MDK Antibody
A44138-50UG 50 µg

MDK Antibody

Sign In for Pricing
View Details
LRRC8B Recombinant Protein (Mouse)
RP148361 100 µg

LRRC8B Recombinant Protein (Mouse)

Sign In for Pricing
View Details