Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VHL, Human (His)

VHL protein is an important component of the von Hippel-Lindau ubiquitination complex and plays a key role in ubiquitination and proteasomal degradation. As a target recruitment subunit in the E3 ubiquitin ligase complex, VHL specifically recruits hydroxylated hypoxia-inducible factor (HIF) under normoxic conditions and regulates cellular responses to oxygen levels. VHL Protein, Human (His) is the recombinant human-derived VHL protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

VHL Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vhl-protein-human-his-avi.html

Purity

90.00

Smiles

MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD

Molecular Formula

7428 (Gene_ID) P40337 (M1-D213) (Accession)

Molecular Weight

Approximately 34 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

RTN4 (Reticulon 4) BioAssayTM ELISA Kit (Human) discontinued
358609-01 48 Tests

RTN4 (Reticulon 4) BioAssayTM ELISA Kit (Human) discontinued

Ask
View Details
RTN4 (Reticulon 4) BioAssayTM ELISA Kit (Human) discontinued
358609-02 96 Tests

RTN4 (Reticulon 4) BioAssayTM ELISA Kit (Human) discontinued

Ask
View Details
GENLISA™ Human G Protein Alpha Transducing Activity Polypeptide 1 (GNaT1) ELISA
KBH21022 1x 96 Well

GENLISA™ Human G Protein Alpha Transducing Activity Polypeptide 1 (GNaT1) ELISA

Ask
View Details
Gpihbp1 Rat siRNA Oligo Duplex (Locus ID 300027)
SR513745 1 Kit

Gpihbp1 Rat siRNA Oligo Duplex (Locus ID 300027)

Ask
View Details
Cy3 Linked Monoclonal Antibody to Hearttype Fatty Acid Binding Protein (HFABP)
MBS2132706-01 0.1 mL

Cy3 Linked Monoclonal Antibody to Hearttype Fatty Acid Binding Protein (HFABP)

Ask
View Details
Cy3 Linked Monoclonal Antibody to Hearttype Fatty Acid Binding Protein (HFABP)
MBS2132706-02 0.2 mL

Cy3 Linked Monoclonal Antibody to Hearttype Fatty Acid Binding Protein (HFABP)

Ask
View Details