Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VHL, Human (His)

VHL protein is an important component of the von Hippel-Lindau ubiquitination complex and plays a key role in ubiquitination and proteasomal degradation. As a target recruitment subunit in the E3 ubiquitin ligase complex, VHL specifically recruits hydroxylated hypoxia-inducible factor (HIF) under normoxic conditions and regulates cellular responses to oxygen levels. VHL Protein, Human (His) is the recombinant human-derived VHL protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

VHL Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vhl-protein-human-his-avi.html

Purity

90.00

Smiles

MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD

Molecular Formula

7428 (Gene_ID) P40337 (M1-D213) (Accession)

Molecular Weight

Approximately 34 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse VPS10 domain-containing receptor SorCS3, SORCS3 ELISA Kit
MBS9325385-01 48 Well

Mouse VPS10 domain-containing receptor SorCS3, SORCS3 ELISA Kit

Ask
View Details
Mouse VPS10 domain-containing receptor SorCS3, SORCS3 ELISA Kit
MBS9325385-02 96 Well

Mouse VPS10 domain-containing receptor SorCS3, SORCS3 ELISA Kit

Ask
View Details
Mouse VPS10 domain-containing receptor SorCS3, SORCS3 ELISA Kit
MBS9325385-03 5x 96 Well

Mouse VPS10 domain-containing receptor SorCS3, SORCS3 ELISA Kit

Ask
View Details
Mouse VPS10 domain-containing receptor SorCS3, SORCS3 ELISA Kit
MBS9325385-04 10x 96 Well

Mouse VPS10 domain-containing receptor SorCS3, SORCS3 ELISA Kit

Ask
View Details
PRAGMIN (PRAG1) Human Gene Knockout Kit (CRISPR)
KN426391 1 Kit

PRAGMIN (PRAG1) Human Gene Knockout Kit (CRISPR)

Ask
View Details
Rabbit Monoclonal Thyroid Peroxidase Antibody (TPO/7088R) [Alexa Fluor 700]
NBP3-21049AF700 0.1 mL

Rabbit Monoclonal Thyroid Peroxidase Antibody (TPO/7088R) [Alexa Fluor 700]

Ask
View Details