Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VHL, Human (His)

VHL protein is an important component of the von Hippel-Lindau ubiquitination complex and plays a key role in ubiquitination and proteasomal degradation. As a target recruitment subunit in the E3 ubiquitin ligase complex, VHL specifically recruits hydroxylated hypoxia-inducible factor (HIF) under normoxic conditions and regulates cellular responses to oxygen levels. VHL Protein, Human (His) is the recombinant human-derived VHL protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

VHL Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vhl-protein-human-his-avi.html

Purity

90.00

Smiles

MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD

Molecular Formula

7428 (Gene_ID) P40337 (M1-D213) (Accession)

Molecular Weight

Approximately 34 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIPG Mouse Monoclonal Antibody [Clone ID: OTI6B9]
TA500999S 30 µL

LIPG Mouse Monoclonal Antibody [Clone ID: OTI6B9]

Sign In for Pricing
View Details
Mouse Amphiregulin MAb (Clone 206220)
MAB989-100 100 µg

Mouse Amphiregulin MAb (Clone 206220)

Sign In for Pricing
View Details
Fas Recombinant Protein
orb1230142 50 µg

Fas Recombinant Protein

Sign In for Pricing
View Details
GTPBP8 Human qPCR Template Standard (NM_014170)
HK210161 1 Kit

GTPBP8 Human qPCR Template Standard (NM_014170)

Sign In for Pricing
View Details
BRSK2 Rabbit Polyclonal Antibody (BF488)
orb2540695 100 µL

BRSK2 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
Mouse Monoclonal dedicator of cytokinesis 8 Antibody (OTI4F3) [Alexa Fluor 594]
NBP2-72226AF594 0.1 mL

Mouse Monoclonal dedicator of cytokinesis 8 Antibody (OTI4F3) [Alexa Fluor 594]

Sign In for Pricing
View Details