Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSF1R, Mouse (HEK293, His)

The CSF1R protein is a tyrosine protein kinase receptor for CSF1 and IL34 and plays a critical regulatory role in hematopoietic cells, especially mononuclear phagocytes. Its effects span innate immunity, inflammation, osteoclast function, skeletal development, and fertility. CSF1R Protein, Mouse (HEK293, His) is the recombinant mouse-derived CSF1R protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CSF1R Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/csf1r-protein-mouse-hek293-his-fc.html

Purity

97.00

Smiles

APVIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGDTKLEIPLNSDFQDNYYKKVRALSLNAVDFQDAGIYSCVASNDVGTRTATMNFQVVESAYLNLTSEQSLLQEVSVGDSLILTVHADAYPSIQHYNWTYLGPFFEDQRKLEFITQRAIYRYTFKLFLNRVKASEAGQYFLMAQNKAGWNNLTFELTLRYPPEVSVTWMPVNGSDVLFCDVSGYPQPSVTWMECRGHTDRCDEAQALQVWNDTHPEVLSQKPFDKVIIQSQLPIGTLKHNMTYFCKTHNSVGNSSQYFRAVSLGQSKQLPDES

Molecular Formula

12978 (Gene_ID) P09581/NP_001032948.2 (A20-S511) (Accession)

Molecular Weight

Approximately 75-100 kDa due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD247/CD3-ZETA Protein (GST Tag)
PDEH100665-01 20 µg

Recombinant Human CD247/CD3-ZETA Protein (GST Tag)

Sign In for Pricing
View Details
Recombinant Human CD247/CD3-ZETA Protein (GST Tag)
PDEH100665-02 100 µg

Recombinant Human CD247/CD3-ZETA Protein (GST Tag)

Sign In for Pricing
View Details
Recombinant Human CD247/CD3-ZETA Protein (GST Tag)
PDEH100665-03 500 µg

Recombinant Human CD247/CD3-ZETA Protein (GST Tag)

Sign In for Pricing
View Details
Recombinant Human CD247/CD3-ZETA Protein (GST Tag)
PDEH100665-04 1 mg

Recombinant Human CD247/CD3-ZETA Protein (GST Tag)

Sign In for Pricing
View Details
Human Nuclear Receptor Subfamily 3, Group C, Member 1 (NR3C1) ELISA Kit
RD-NR3C1-Hu-01 96 Tests

Human Nuclear Receptor Subfamily 3, Group C, Member 1 (NR3C1) ELISA Kit

Sign In for Pricing
View Details
Human Nuclear Receptor Subfamily 3, Group C, Member 1 (NR3C1) ELISA Kit
RD-NR3C1-Hu-02 48 Tests

Human Nuclear Receptor Subfamily 3, Group C, Member 1 (NR3C1) ELISA Kit

Sign In for Pricing
View Details