Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSF1R, Mouse (HEK293, His)

The CSF1R protein is a tyrosine protein kinase receptor for CSF1 and IL34 and plays a critical regulatory role in hematopoietic cells, especially mononuclear phagocytes. Its effects span innate immunity, inflammation, osteoclast function, skeletal development, and fertility. CSF1R Protein, Mouse (HEK293, His) is the recombinant mouse-derived CSF1R protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CSF1R Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/csf1r-protein-mouse-hek293-his-fc.html

Purity

97.00

Smiles

APVIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGDTKLEIPLNSDFQDNYYKKVRALSLNAVDFQDAGIYSCVASNDVGTRTATMNFQVVESAYLNLTSEQSLLQEVSVGDSLILTVHADAYPSIQHYNWTYLGPFFEDQRKLEFITQRAIYRYTFKLFLNRVKASEAGQYFLMAQNKAGWNNLTFELTLRYPPEVSVTWMPVNGSDVLFCDVSGYPQPSVTWMECRGHTDRCDEAQALQVWNDTHPEVLSQKPFDKVIIQSQLPIGTLKHNMTYFCKTHNSVGNSSQYFRAVSLGQSKQLPDES

Molecular Formula

12978 (Gene_ID) P09581/NP_001032948.2 (A20-S511) (Accession)

Molecular Weight

Approximately 75-100 kDa due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TORC2 (CRTC2) (542-553) Goat Polyclonal Antibody
AP32806PU-N 100 µg

TORC2 (CRTC2) (542-553) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Macrophages Mouse Monoclonal Antibody [Clone ID: AnP95]
AM26064PU-N 100 µg

Macrophages Mouse Monoclonal Antibody [Clone ID: AnP95]

Sign In for Pricing
View Details
CP-775146
TRC-C781355-1MG 1 mg

CP-775146

Sign In for Pricing
View Details
TGFalpha (P/T1), CF647 conjugate, 0.1mg/mL
BNC470787-500 1x 500 µL

TGFalpha (P/T1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Testis
CS505821 5x 5 µm

Frozen Tissue Sections, Testis

Sign In for Pricing
View Details
HBZ Rabbit Polyclonal Antibody
TA370712 100 µL

HBZ Rabbit Polyclonal Antibody

Sign In for Pricing
View Details