Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSF1R, Mouse (HEK293, His)

The CSF1R protein is a tyrosine protein kinase receptor for CSF1 and IL34 and plays a critical regulatory role in hematopoietic cells, especially mononuclear phagocytes. Its effects span innate immunity, inflammation, osteoclast function, skeletal development, and fertility. CSF1R Protein, Mouse (HEK293, His) is the recombinant mouse-derived CSF1R protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CSF1R Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/csf1r-protein-mouse-hek293-his-fc.html

Purity

97.00

Smiles

APVIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGDTKLEIPLNSDFQDNYYKKVRALSLNAVDFQDAGIYSCVASNDVGTRTATMNFQVVESAYLNLTSEQSLLQEVSVGDSLILTVHADAYPSIQHYNWTYLGPFFEDQRKLEFITQRAIYRYTFKLFLNRVKASEAGQYFLMAQNKAGWNNLTFELTLRYPPEVSVTWMPVNGSDVLFCDVSGYPQPSVTWMECRGHTDRCDEAQALQVWNDTHPEVLSQKPFDKVIIQSQLPIGTLKHNMTYFCKTHNSVGNSSQYFRAVSLGQSKQLPDES

Molecular Formula

12978 (Gene_ID) P09581/NP_001032948.2 (A20-S511) (Accession)

Molecular Weight

Approximately 75-100 kDa due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHST8 (NM_001127896) Human Over-expression Lysate
LY426882 100 µg

CHST8 (NM_001127896) Human Over-expression Lysate

Sign In for Pricing
View Details
CARD11 Antibody
8C12113-AAT 50 µg

CARD11 Antibody

Sign In for Pricing
View Details
3,4-Xylenol Phosphate
TRC-X749555-5G 5 g

3,4-Xylenol Phosphate

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse Ly6G Antibody[1A8]
E-AB-F1108UM-01 25 µg

Elab Fluor® 647 Anti-Mouse Ly6G Antibody[1A8]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse Ly6G Antibody[1A8]
E-AB-F1108UM-02 100 µg

Elab Fluor® 647 Anti-Mouse Ly6G Antibody[1A8]

Sign In for Pricing
View Details
MBNL1 (NM_207294) Human Over-expression Lysate
LC404077 20 µg

MBNL1 (NM_207294) Human Over-expression Lysate

Sign In for Pricing
View Details