Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSF1R, Mouse (HEK293, His)

The CSF1R protein is a tyrosine protein kinase receptor for CSF1 and IL34 and plays a critical regulatory role in hematopoietic cells, especially mononuclear phagocytes. Its effects span innate immunity, inflammation, osteoclast function, skeletal development, and fertility. CSF1R Protein, Mouse (HEK293, His) is the recombinant mouse-derived CSF1R protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CSF1R Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/csf1r-protein-mouse-hek293-his-fc.html

Purity

97.00

Smiles

APVIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGDTKLEIPLNSDFQDNYYKKVRALSLNAVDFQDAGIYSCVASNDVGTRTATMNFQVVESAYLNLTSEQSLLQEVSVGDSLILTVHADAYPSIQHYNWTYLGPFFEDQRKLEFITQRAIYRYTFKLFLNRVKASEAGQYFLMAQNKAGWNNLTFELTLRYPPEVSVTWMPVNGSDVLFCDVSGYPQPSVTWMECRGHTDRCDEAQALQVWNDTHPEVLSQKPFDKVIIQSQLPIGTLKHNMTYFCKTHNSVGNSSQYFRAVSLGQSKQLPDES

Molecular Formula

12978 (Gene_ID) P09581/NP_001032948.2 (A20-S511) (Accession)

Molecular Weight

Approximately 75-100 kDa due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAD51 (Prognostic and Response to Chemotherapy Marker) (RAD51/2753), CF640R conjugate, 0.1mg/mL
BNC402753-500 1x 500 µL

RAD51 (Prognostic and Response to Chemotherapy Marker) (RAD51/2753), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KPNB1 Mouse Monoclonal Antibody [Clone ID: OTI6H3]
CF811718 100 µg

KPNB1 Mouse Monoclonal Antibody [Clone ID: OTI6H3]

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike S1 (K417N, E484K, N501Y, D614G) (His Tag)
PKSV030361 100 µg

Recombinant SARS-CoV-2 Spike S1 (K417N, E484K, N501Y, D614G) (His Tag)

Sign In for Pricing
View Details
PDCD1 / PD1 / CD279 (Programmed Cell Death 1), CF488A conjugate, 0.1mg/mL
BNC881457-100 1x 100 µL

PDCD1 / PD1 / CD279 (Programmed Cell Death 1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-(4-Aminophenyl)propanoic Acid
TRC-A622690-250MG 250 mg

2-(4-Aminophenyl)propanoic Acid

Sign In for Pricing
View Details
ST7 (Center) Rabbit Polyclonal Antibody
AP54058PU-N 400 µL

ST7 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details