Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-3, Rhesus macaque (His)

IL-3 protein, a hematopoietic cytokine, regulates hematopoiesis by influencing the production, differentiation, and function of various white blood cell populations. It acts as a colony-stimulating factor, promoting the development and maturation of these cell types and maintaining a functional immune system. IL-3 Protein, Rhesus macaque (His) is the recombinant Rhesus Macaque-derived IL-3 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-3 Protein, Rhesus macaque (His), Rhesus Macaque, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-3-protein-rhesus-macaque-his.html

Purity

95.0

Smiles

APMTQTTSLKTSWAKCSNMIDEIITHLNQPPLPSPDFNNLNEEDQTILVEKNLRRSNLEAFSKAVKSLQNASAIESILKNLPPCLPMATAAPTRPPIRITNGDRNDFRRKLKFYLKTLENEQAQ

Molecular Formula

706946 (Gene_ID) P25140 (A20-Q143) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Beta-Actin/HRP Recombinant Antibody
bsm-52846R-TR 20 µL

Beta-Actin/HRP Recombinant Antibody

Sign In for Pricing
View Details
NCI-H526 Cell Line
RWT-527 1x 10^6

NCI-H526 Cell Line

Sign In for Pricing
View Details
PMS2P11 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV741113 1.0 µg DNA

PMS2P11 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
SYNGR2 Rabbit Polyclonal Antibody
orb579803 100 µL

SYNGR2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Arhgdig (BC002032) Mouse Tagged ORF Clone
MG202640 10 µg

Arhgdig (BC002032) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
SEC22B Protein Vector (Rat) (pPM-C-His)
PV303849 500 ng

SEC22B Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details